Dbfetch

ID   DQ916147; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   DQ916147;
XX
DT   17-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*16 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/j.1399-0039.2006.00799.x.
RX   PUBMED; 17389029.
RA   Canossi A., Liberatore G., Del Beato T., Oumhani K., Adorno D.;
RT   "Sequence-based typing characterization of the novel HLA-Cw*1609 allele in
RT   the Moroccan Chaouya group";
RL   Tissue Antigens 69(4):367-370(2007).
XX
RN   [2]
RP   1-1022
RA   Canossi A., Oumhani K., Liberatore G., Del Beato T., Piancatelli D.,
RA   El Aouad R., Adorno D.;
RT   "A novel HLA-Cw*16 allele variant in a DNA sample from Moroccan Chaouya
RT   ethnic group (healthy volunteer)";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Canossi A., Oumhani K., Liberatore G., Del Beato T., Piancatelli D.,
RA   El Aouad R., Adorno D.;
RT   ;
RL   Submitted (24-AUG-2006) to the INSDC.
RL   C.N.R. Istituto Trapianti D'Organo e l'Immunocitologia, P.le Collemaggio,
RL   L'Aquila 67100, Italy
XX
DR   MD5; ce9060d912da34b75f27253c2e45414d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="E355"
FT                   /mol_type="genomic DNA"
FT                   /country="Morocco"
FT                   /isolation_source="healthy volunteer of Chaouya ethnic
FT                   group"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*16 variant"
FT                   /note="similar to HLA-Cw*1602 allele"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*16 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*16 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q09GE6"
FT                   /db_xref="IMGT/HLA:C*16:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q09GE6"
FT                   /protein_id="ABI55240.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPQYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*16 variant"
FT                   /number=2
FT   variation       171
FT                   /gene="HLA-Cw"
FT                   /replace="g"
FT                   /compare=X76189.1
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*16 variant"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*16 variant"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 171 A; 255 C; 285 G; 111 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg cagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgcggcgga gcagcagaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatctcgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acgtgccatg tgcagcacga ggggctgccg gagcccctca ccctgagatg      1020
     gg                                                                     1022
//