Dbfetch

ID   DQ915176; SV 2; linear; genomic DNA; STD; HUM; 1819 BP.
XX
AC   DQ915176;
XX
DT   26-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*27 new allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1819
RX   DOI; 10.1111/j.1399-0039.2006.00796.x.
RX   PUBMED; 17389027.
RA   Li Z., Zou H.Y., Shao C.P., Tang S., Wang D.M.;
RT   "Identification of a novel HLA-B*56 allele, B*5618 and an extension of
RT   B*2736 by sequence-based typing";
RL   Tissue Antigens 69(4):365-366(2007).
XX
RN   [2]
RP   1-1819
RA   Li Z., Zou H.-Y., Shao C.-P., Cheng L.-H., Xiong W., Zhou D., Zhang Y.-Z.;
RT   "A new HLA-B*27 allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-1819
RA   Li Z., Zou H.-Y., Shao C.-P., Cheng L.-H., Xiong W., Zhou D., Zhang Y.-Z.;
RT   ;
RL   Submitted (22-AUG-2006) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
RN   [4]
RC   Sequence update by submitter
RP   1-1819
RA   Li Z., Zou H.-Y., Shao C.-P., Cheng L.-H., Xiong W., Zhou D., Zhang Y.-Z.;
RT   ;
RL   Submitted (19-OCT-2006) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; b8d37255885032bea9a64b825993c650.
XX
CC   On Oct 19, 2006 this sequence version replaced gi:115279687.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1819
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT   mRNA            join(<1..270,515..790,1365..>1640)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,515..790,1365..>1640)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q06BD1"
FT                   /db_xref="IMGT/HLA:B*27:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q06BD1"
FT                   /protein_id="ABI85322.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDRESLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /number=2
FT   exon            515..790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /number=3
FT   variation       634
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="in HLA-B*270401 allele"
FT   variation       670
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="in HLA-B*270401 allele"
FT   variation       683
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="in HLA-B*270401 allele"
FT   variation       698
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="in HLA-B*270401 allele"
FT   variation       774
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="in HLA-B*270401 allele"
FT   variation       776
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="in HLA-B*270401 allele"
FT   variation       781
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="in HLA-B*270401 allele"
FT   variation       789
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="in HLA-B*270401 allele"
FT   exon            1365..>1640
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /number=4
FT   variation       1438
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="in HLA-B*270401 allele"
FT   variation       1449
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="in HLA-B*270401 allele"
XX
SQ   Sequence 1819 BP; 347 A; 563 C; 573 G; 336 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagagagc ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     ggggggacgg ggctgaccgc ggggccgggg ccagggtctc acaccctcca gaatatgtat       540
     ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt accaccagga cgcctacgac       600
     ggcaaggatt acatcgccct gaacgaggac ctgcgctcct ggaccgccgc ggacacggcg       660
     gctcagatct cccagcgcaa gttggaggcg gcccgtgtgg cggagcagct gagagcctac       720
     ctggagggcg agtgcgtgga gtggctccgc agatacctgg agaacgggaa ggacaagctg       780
     gagcgcgctg gtaccagggg cagtggggag ccttccccat ctcctatagg tcgccgggga       840
     tggcctccca cgagaagagg aggaaaatgg gatcagcgct agaatgtcgc cctccgttga       900
     atggagaatg gcatgagttt tcctgagttt cctctgaggg ccccctcttc tctctagaca       960
     attaaggaat gacgtctctg aggaaatgga ggggaagaca gtccctagaa tactgatcag      1020
     gggtcccctt tgacccctgc agcagccttg ggaaccgtga cttttcctct caggccttgt      1080
     tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga gtcactttac      1140
     ctccactcag atcaggagca gaagtccctg ttccccgctc agagactcga actttccaat      1200
     gaataggaga ttatcccagg tgcctgcgtc caggctggtg tctgggttct gtgccccttc      1260
     cccaccccag gtgtcctgtc cattctcagg ctggtcacat gggtggtcct agggtgtccc      1320
     atgaaagatg caaagcgcct gaattttctg actcttccca tcagaccccc caaagacaca      1380
     cgtgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg ccctgggttt      1440
     ctaccctgcg gagatcacac tgacctggca gcgggatggc gaggaccaaa ctcaggacac      1500
     tgagcttgtg gagaccagac cagcaggaga tagaaccttc cagaagtggg cagctgtggt      1560
     ggtgccttct ggagaagagc agagatacac atgccatgta cagcatgagg ggctgccgaa      1620
     gcccctcacc ctgagatggg gtaaggaggg ggatgagggg tcatatctct tctcagggaa      1680
     agcaggagcc cttcagcagg gtcagggccc ctcatcttcc cctcctttcc cagagccgtc      1740
     ttcccagtcc accgtcccca tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt      1800
     ggtcatcgga gctgtggtc                                                   1819
//