Dbfetch

ID   DQ914641; SV 1; linear; genomic DNA; STD; HUM; 1107 BP.
XX
AC   DQ914641;
XX
DT   03-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40XX allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1107
RA   Jin W., Du D., Gao H., Liu X., Li L., Kong F., Fan L.-a., Gong F., Cai J.;
RT   "Identification of a novel HLA-B allele (HLA-B*40XX)";
RL   Unpublished.
XX
RN   [2]
RP   1-1107
RA   Jin W., Du D., Gao H., Liu X., Kong F., Fan L.-a., Gong F., Cai J.;
RT   ;
RL   Submitted (22-AUG-2006) to the INSDC.
RL   Technology Dept., The Data Bank of Chinese Hematopoietic Stem Cell Donors
RL   (Chinese Marrow Donors Program), 53 Ganmian Hutong, Dongcheng District,
RL   Beijing 100010, China
XX
DR   MD5; d919c6fc8ea24c3f6f953ade894f5ba6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1107
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <60..>1051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40XX"
FT   mRNA            join(<60..132,262..531,776..>1051)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40XX"
FT                   /product="MHC class I antigen"
FT   CDS             join(60..132,262..531,776..>1051)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40XX"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*40:70:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:A5H2C3"
FT                   /protein_id="ABK51451.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRA"
FT   exon            60..132
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40XX"
FT                   /number=1
FT   exon            262..531
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40XX"
FT                   /number=2
FT   exon            776..>1051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40XX"
FT                   /number=3
XX
SQ   Sequence 1107 BP; 189 A; 367 C; 405 G; 146 T; 0 other;
     gtcccagttc taaagtcccc acgcacccac ccggactcag aatctcctca gacgccgaga        60
     tgcgggtcac ggcgccccga accctcctcc tgctgctctg gggggcagtg gccctgaccg       120
     agacctgggc tggtgagtgc ggggtcggca gggaaatggc ctctgtgggg aggagcgagg       180
     ggaccgcagg cgggggcgca ggacccgggg agccgcgccg ggaggagggt cgggcgggtc       240
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttccacacc tccgtgtccc       300
     ggcccggccg cggggagccc cgcttcatca ccgtgggcta cgtggacgac acgctgttcg       360
     tgaggttcga cagcgacgcc acgagtccga ggaaggagcc gcgggcgcca tggatagagc       420
     aggaggggcc ggagtattgg gaccgggaga cacagatctc caagaccaac acacagactt       480
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       540
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       600
     gtctccgggt ccgagatccg cccccgaggc cgcgggaccc gcccagaccc tcgaccggcg       660
     agagccccag gcgcgtttac ccggtttcat tttcagttga ggccaaaatc cccgcgggtt       720
     ggtcggggcg gggcggggct cggggggacg gggctgaccg cgggggcggg gccagggtct       780
     cacacttggc agacgatgta tggctgcgac ctggggccgg acgggcgcct cctccgcggg       840
     cataaccagt acgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctcc       900
     tggaccgccg cggacacggc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg       960
     gcggagcagc tgagagccta cctggagggc gagtgcgtgg agtggctccg cagatacctg      1020
     gagaacggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca      1080
     tctcctatag gtcgccgggg atggcct                                          1107
//