Dbfetch

ID   DQ905958; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ905958;
XX
DT   15-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2007.00938.x.
RX   PUBMED; 17990991.
RA   Liu N., Zhang Z.;
RT   "Identified a novel allele HLA-A*240212 by sequence-based typing";
RL   Tissue Antigens 70(6):516-517(2007).
XX
RN   [2]
RP   1-270
RA   Zhang Z., Wang L., Shan X., Li W., Wang Z., He X., Ni L., Wang L., Liu N.,
RA   Cui S., Zhu J.;
RT   "A Novel HLA-A*24 Allele Identified Sequence-based type";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Zhang Z., Wang L., Shan X., Li W., Wang Z., He X., Ni L., Wang L., Liu N.,
RA   Cui S., Zhu J.;
RT   ;
RL   Submitted (16-AUG-2006) to the INSDC.
RL   Histocompatibility Lab, Red Cross Blood Center, No.37 North Third Ring
RL   Road, Beijing 100088, China
XX
DR   MD5; c244235b79a07b7fff367087d5cb7684.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:02:12"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A7YGF0"
FT                   /protein_id="ABI34469.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 83 C; 95 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaat ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//