spacer

EBI Dbfetch

ID   DQ902552; SV 1; linear; genomic DNA; STD; HUM; 1838 BP.
XX
AC   DQ902552;
XX
DT   23-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2506 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1838
RA   Martin L.S., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (15-AUG-2006) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 8e9112b3fc78de880bffa5e2d3d4e46c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1838
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1838
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT   mRNA            join(<67..336,579..854,1455..1730,1830..>1838)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT                   /product="MHC class I antigen"
FT   CDS             join(<67..336,579..854,1455..1730,1830..>1838)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q06FC4"
FT                   /db_xref="IMGT/HLA:A*25:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q06FC4"
FT                   /protein_id="ABI78963.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRESLRIALRYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPS"
FT   exon            67..336
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT                   /number=2
FT   exon            579..854
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT                   /number=3
FT   exon            1455..1730
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT                   /number=4
FT   exon            1830..>1838
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2506"
FT                   /number=5
XX
SQ   Sequence 1838 BP; 351 A; 568 C; 586 G; 333 T; 0 other;
     gcgcaggacc cgggaagccg cgcctggagg agggtcgggc gggtctcagc cactcctcgc        60
     ccccaggctc ccactccatg aggtatttct acacctccgt gtcccggccc ggccgcgggg       120
     agccccgctt catcgccgtg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg       180
     acgccgcgag ccagaggatg gagccgcggg cgccgtggat agagcaggag gggccggagt       240
     attgggaccg gaacacacgg aatgtgaagg cccactcaca gactgaccga gagagcctgc       300
     ggatcgcgct ccgctactac aaccagagcg aggacggtga gtgaccccgg cccggggcgc       360
     aggtcacgac ccctcatccc ccacggacgg gccaggtcgc ccacagtctc cgggtccgag       420
     atccgccccg aagccgcggg acccccgaga cccttgcccc gggagaggcc caggcgcctt       480
     tacccggttt cattttcagt ttaggccaaa aatccccccg ggttggtcgg ggcggggcgg       540
     ggctcggggg accgggctga cctcggggtc cgggccaggt tctcacacca tccagaggat       600
     gtatggctgc gacgtggggc cggacgggcg cttcctccgc gggtaccagc aggacgctta       660
     cgacggcaag gattacatcg ccctgaacga ggacctgcgc tcttggaccg cggcggacat       720
     ggcggctcag atcacccagc gcaagtggga gacggcccat gaggcggagc agtggagagc       780
     ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac       840
     gctgcagcgc acgggtacca ggggccacgg ggcgcctccc tgatcgcctg tagatctccc       900
     gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata tcgccctccc       960
     tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag agagtgactc      1020
     tgaggttccg ccctgctctc tgacacaatt aagggataaa atctctgaag gaatgacggg      1080
     aagacgatcc ctcgaatact gatgagtggt tccctttgac acacaccggc agcagccttg      1140
     ggcccgtgac ttttcctctc aggccttgtt ctctgcttca cactcaatgt gtgtgggggt      1200
     ctgagtccag cacttctgag tccctcagcc tccactcagg tcaggaccag aagtcgctgt      1260
     tccctcttca gggactagaa ttttccacgg aataggagat tatcccaggt gcctgtgtcc      1320
     aggctggtgt ctgggttctg tgctcccttc cccatcccag gtgtcctgtc cattctcaag      1380
     atagccacat gtgtgctgga ggagtgtccc atgacagatg caaaatgcct gaatgttctg      1440
     actcttcctg acagacgccc ccaagacgca tatgactcac cacgctgtct ctgaccatga      1500
     ggccaccctg aggtgctggg ccctgagctt ctaccctgcg gagatcacac tgacctggca      1560
     gcgggatggg gaggaccaga cccaggacac ggagctcgtg gagaccaggc ctgcagggga      1620
     tgggaccttc cagaagtggg cgtctgtggt ggtgccttct ggacaggagc agagatacac      1680
     ctgccatgtg cagcatgagg gtctgcccaa gcccctcacc ctgagatggg gtaaggaggg      1740
     agacgggggt gtcatgtctt ttagggaaag caggagcctc tctgaccttt agcagggtca      1800
     gggcccctca ccttcccctc ttttcccaga gccgtctt                              1838
//


spacer
spacer