Dbfetch

ID   DQ886702; SV 1; linear; genomic DNA; STD; HUM; 1791 BP.
XX
AC   DQ886702;
XX
DT   19-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*180103 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1791
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele B*180103";
RL   Unpublished.
XX
RN   [2]
RP   1-1791
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (07-AUG-2006) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 6eb06f6f6a4fe15debc8ede6189c5c1d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*180103"
FT   mRNA            join(<53..322,569..844,1417..>1692)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*180103"
FT                   /product="MHC class I antigen"
FT   CDS             join(<53..322,569..844,1417..>1692)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*180103"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q09JY6"
FT                   /db_xref="IMGT/HLA:B*18:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q09JY6"
FT                   /protein_id="ABI63584.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            53..322
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*180103"
FT                   /number=2
FT   exon            569..844
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*180103"
FT                   /number=3
FT   exon            1417..1692
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*180103"
FT                   /number=4
XX
SQ   Sequence 1791 BP; 344 A; 564 C; 566 G; 317 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tccttgcccc aggctcccac        60
     tccatgaggt atttccacac ctccgtgtcc cggcccggcc gcggggagcc ccgcttcatc       120
     tcagtgggct acgtggacgg cacccagttc gtgaggttcg acagcgacgc cgcgagtccg       180
     aggacggagc cccgggcgcc gtggatagag caagaggggc cggagtattg ggaccggaac       240
     acacagatct ccaagaccaa cacacagact taccgagaga gcctgcggaa cctgcgcggc       300
     tactacaacc agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgactccc       360
     catcccccac gtacggcccg ggtcgccccg agtctccggg tccgagatcc gcccccctga       420
     ggccgcggga cccgcccaga ccctcgaccg gcgagagccc caggcgcgtt tacccggttt       480
     cattttcagt tgaggccaaa atccccgcgg gttggtcggg gcggggcggg gctcgggggg       540
     acggggctga ccgcggggcc ggggccaggg tctcacaccc tccagaggat gtacggctgc       600
     gacgtggggc cggacgggcg cctcctccgc gggcatgacc agtccgccta cgacggcaag       660
     gattacatcg ccctgaacga ggacctgagc tcctggaccg cggcggacac cgcggctcag       720
     atcacccagc gcaagtggga ggcggcccgt gtggcggagc agctgagagc ctacctggag       780
     ggcacgtgcg tggagtggct ccgcagacac ctggagaacg ggaaggagac gctgcagcgc       840
     gcgggtacca ggggcagtgg ggagccttcc ccatctccta taggtcgccg gggatggcct       900
     cccacgagaa gaggaggaaa atgggatcag cgctagaatg tcgccctccc ttgaatggag       960
     aatggcatga gttttcccga gtttcctctg agggccccct cttctctcta ggacaattaa      1020
     gggatgacgt ctctgaggaa atggagggga agacagtccc tagaatactg atcaggggtc      1080
     ccctttgacc cctgcagcag ccttgggaac catgactttt cctctcaggc cttgttctct      1140
     gcctcacact cagtgtgttt ggggctctga ttccagcact tctgagtcac tttacctcca      1200
     ctcagatcag gagcagaagt ctctgttccc cgctcagaga ctcgaacttt ccaatgaata      1260
     gattatccca ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc      1320
     aggtgtcctg tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga      1380
     tgcaaagcgc ctgaattttc tgactcttcc catcagaccc cccaaagaca catgtgaccc      1440
     accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg      1500
     cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg      1560
     tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt      1620
     ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca      1680
     ccctgagatg gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag      1740
     cccttctgga gcccttcagc agggtcaggg cccctcatct tcccctcctt t               1791
//