Dbfetch

ID   DQ872509; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   DQ872509;
XX
DT   29-AUG-2006 (Rel. 88, Created)
DT   14-DEC-2010 (Rel. 107, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*3018 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/j.1399-0039.2006.00785.x.
RX   PUBMED; 17493156.
RA   Zou H.Y., Li Z., Shao C.P., Cheng L.H., Xiong W.;
RT   "A new HLA-A*30 variant, A*3018, identified by sequence-based typing in the
RT   Chinese population";
RL   Tissue Antigens 69(3):281-282(2007).
XX
RN   [2]
RP   1-1022
RA   Zou H.-Y., Li Z., Shao C.-P., Cheng L.-H., Xiong W., Zhou D., Zhang Y.-Z.;
RT   "A new HLA-A*30 allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Zou H.-Y., Li Z., Shao C.-P., Cheng L.-H., Xiong W., Zhou D., Zhang Y.-Z.;
RT   ;
RL   Submitted (28-JUL-2006) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; cefd475ae1512b625ff04bf3da3f2cb8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3018"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3018"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3018"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*30:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GC70"
FT                   /protein_id="ABI31649.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARWAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3018"
FT                   /number=2
FT   variation       48
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="compared to HLA-A*300101"
FT   variation       50
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="compared to HLA-A*300101"
FT   variation       53
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="compared to HLA-A*300101"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3018"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3018"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 169 A; 248 C; 283 G; 122 T; 200 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtatga acagcacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gttgggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca catatgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggagagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//