Dbfetch

ID   DQ869010; SV 1; linear; genomic DNA; STD; HUM; 1817 BP.
XX
AC   DQ869010;
XX
DT   27-AUG-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*150107 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1817
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a novel allele B*150107";
RL   Unpublished.
XX
RN   [2]
RP   1-1817
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (27-JUL-2006) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 17fa52d10369986485b8700447858ea9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1817
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1817
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT   mRNA            join(<63..332,578..853,1429..1704,1809..>1817)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT                   /product="MHC class I antigen"
FT   CDS             join(<63..332,578..853,1429..1704,1809..>1817)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*15:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GF39"
FT                   /protein_id="ABI26620.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS"
FT   exon            63..332
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT                   /number=2
FT   exon            578..853
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT                   /number=3
FT   exon            1429..1704
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT                   /number=4
FT   exon            1809..>1817
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*150107"
FT                   /number=5
XX
SQ   Sequence 1817 BP; 334 A; 563 C; 563 G; 315 T; 42 other;
     aggacccggg gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct cctcgccccc        60
     aggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc gcggggagcc       120
     ccgcttcatc gcagtgggct acgtggacga cacccagttc gtgaggttcg acagcgacgc       180
     cgcgagtccg aggatggcgc cccgggcgcc atggatagag caggaggggc cggagtattg       240
     ggaccgggag acacagatct ccaagaccaa cacacagact taccgagaga gcctgcggaa       300
     cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcctg gggcgcaggt       360
     cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg tccgagatcc       420
     gcccccctga ggccgcggga cccgcccaaa ccctcgaccg gcgagagccc caggcgcgtt       480
     tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg gcggggcggg       540
     gctcggggga cggggctgac cgcggggcct gggccagggt ctcacaccct ccagaggatg       600
     tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca gtccgcctac       660
     gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc ggcggacacg       720
     gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca gtggagagcc       780
     tacctggagg gcctgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg       840
     ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcctat aggtcgccgg       900
     ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt cgccctccct       960
     tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc ttctctctnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gacagtccct aggatagtga      1080
     tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc gtgacttttc ctctcaggcc      1140
     ttgttctctg cctcacactc agtgtgtttg gggctctgat tccagcactt ctgagtcact      1200
     ttacctccac tcagatcagg agcagaagtc cctgttcccc gctcagagac tcgaactttc      1260
     caatgaatag gagattatcc caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc      1320
     cttccccacc ccaggtgtcc tgtccattct caggctggtc acatgggtgg tcctagggtg      1380
     tcccatgaga gatgcaaagc gcctgaattt tctgactctt cccatcagac cccccaaaga      1440
     cacatgtgac ccaccacccc atctctgacc atgaggccac cctgaggtgc tgggccctgg      1500
     gcttctaccc tgcggagatc acactgacct ggcagcggga tggtgaggac caaactcagg      1560
     acaccgagct tgtggagacc agaccagcag gagatagaac cttccagaag tgggcagctg      1620
     tggtggtgcc ttctggagaa gagcagagat acacatgcca tgtacagcat gaggggctgc      1680
     cgaagcccct caccctgaga tggggtaagg agggggatga ggggtcatat ctgttctcag      1740
     ggaaagcagg agcccttctg gagcccttca gcagggtcag ggcccctcat cttcccctcc      1800
     tttcccagag ccatctt                                                     1817
//