spacer

EBI Dbfetch

ID   DQ837166; SV 1; linear; genomic DNA; STD; HUM; 377 BP.
XX
AC   DQ837166;
XX
DT   07-AUG-2006 (Rel. 88, Created)
DT   27-JUL-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1611 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-377
RX   DOI; 10.1111/j.1399-0039.2009.01260.x.
RX   PUBMED; 19500310.
RA   Chu C.-C., Lee H.-L., Lin M.;
RT   "A novel HLA-DRB1 allele, DRB*1611, is identified in two Taiwanese
RT   individuals";
RL   Tissue Antigens 74(2):175-176(2009).
XX
RN   [2]
RP   1-377
RA   Chu C.-C.;
RT   ;
RL   Submitted (05-JUL-2006) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taiwan
XX
DR   MD5; 67b925667188780d36e4dfdc1bb0a8ed.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..377
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="K9505074"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>377
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1611"
FT   mRNA            <101..>370
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1611"
FT                   /product="MHC class II antigen"
FT   CDS             <101..>370
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1611"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:11"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="ABH05946.1"
FT                   /translation="RFLWQPKRKCHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            101..370
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1611"
FT                   /number=2
XX
SQ   Sequence 377 BP; 71 A; 106 C; 134 G; 66 T; 0 other;
     ccagcgcccg caccccgctc agggagcccc ggatggtggc gtcgctgtcc gtgtcttctc        60
     aggaggccgc cctgtgaccg gatggttcgt gtccccacag cacgtttcct gtggcagcct       120
     aagaggaagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tataaccagg aggagtccgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgacgc tgagtactgg aacagccaga aggacctcct ggaagacagg       300
     cgcgccgcgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag gtgagca                                                      377
//


spacer
spacer