Dbfetch

ID   DQ836315; SV 1; linear; genomic DNA; STD; HUM; 260 BP.
XX
AC   DQ836315;
XX
DT   07-AUG-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-260
RA   Sayer D.C., Smith L.K., Hogan H.M.;
RT   ;
RL   Submitted (04-JUL-2006) to the INSDC.
RL   Clinical Immunology, Royal Perth Hospital, Wellington St, Perth, WA 6000,
RL   Australia
XX
DR   MD5; 1f525cf3eac7dc329b7409be2cf5b510.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..260
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>260
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT   mRNA            <1..>260
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>260
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q0PGS7"
FT                   /db_xref="IMGT/HLA:DRB1*04:05:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PGS7"
FT                   /protein_id="ABH05926.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV"
FT   exon            1..260
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /number=2
XX
SQ   Sequence 260 BP; 58 A; 62 C; 93 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtacag ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg                                                   260
//