Dbfetch

ID   DQ784564; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   DQ784564;
XX
DT   30-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*03new allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Yu M., Hall J.E.III., Hartman K., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   "A Novel HLA-Cw*03 allele identified by PCR-SBT in an ASHI proficiency test
RT   sample";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Yu M., Hall J.E.III., Hartman K., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   ;
RL   Submitted (16-JUN-2006) to the INSDC.
RL   Histocompatibility and Immunogenetics Laboratory, Children's Memorial
RL   Hospital, 2300 Children's Plaza, Chicago, IL 60614, USA
XX
DR   MD5; 615f679b89950b7b353b40a6df39e80d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: Cin1-For, rev_name: Cint3R-CT"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*03:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PPT7"
FT                   /protein_id="ABG81862.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWKAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT                   /number=3
XX
SQ   Sequence 791 BP; 144 A; 255 C; 284 G; 108 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggcca gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc tcatccccca cggacggccc gggtcgcccc aagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cgggggcggg gccagggtct cacatcatcc agaggatgta       540
     tggctgcgac gtggggcccg acgggcgcct cctccgcggg tatgaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga tctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtggaaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg aagaatggga aggagacgct       780
     gcagcgcgcg g                                                            791
//