spacer

EBI Dbfetch

ID   DQ780571; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   DQ780571;
XX
DT   29-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*03new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Hur S.S., Park S.Y., Lee M.N., Kwon O.J.;
RT   "New HLA-Cw*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Hur S.S., Park S.Y., Lee M.N., Kwon O.J.;
RT   ;
RL   Submitted (15-JUN-2006) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong,, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
DR   MD5; 123e4be97ffa907df8b9cdf4bfb1fc7e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q0PQ78"
FT                   /db_xref="IMGT/HLA:C*03:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PQ78"
FT                   /protein_id="ABG79048.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWKAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   gap             271..515
FT                   /estimated_length=245
XX
SQ   Sequence 791 BP; 109 A; 165 C; 198 G; 74 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacatcatcc agaggatgta       540
     tggctgcgac gtggggcccg acgggcgcct cctccgcggg tatgaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga tctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtggaaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg aagaatggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer