spacer

EBI Dbfetch

ID   DQ666333; SV 1; linear; genomic DNA; STD; HUM; 350 BP.
XX
AC   DQ666333;
XX
DT   12-JUL-2006 (Rel. 88, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03V allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-350
RX   DOI; 10.1111/j.1744-313X.2007.00662.x.
RX   PUBMED; 17373933.
RA   Yang K.L., Chu C.C., Huang C.H., Lin S.Z., Hsu W.L., Liu D.W., Lin P.Y.;
RT   "Discovery of HLA-DRB1*0331 in a Taiwanese marrow donor and the importance
RT   of sequence-based typing in a rare or previously unrecognized allele";
RL   Int. J. Immunogenet. 34(2):91-95(2007).
XX
RN   [2]
RP   1-350
RA   Yang E.K.L.;
RT   ;
RL   Submitted (02-JUN-2006) to the INSDC.
RL   Buddhist Tzu Chi Stem Cells Centre Cord Blood Bank, Tzu Chi General
RL   Hospital, Buddhist Compassion Relief Tzu Chi Foundation, 707, Section 3,
RL   Chung Yang Road, Hualien 970, Taiwan
XX
DR   MD5; 5ca8266ca7ee4743bd00cf82a7a898b0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..350
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>350
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03V"
FT   mRNA            <68..>337
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03V"
FT                   /product="MHC class II antigen"
FT   CDS             <68..>337
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03V"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q0Z850"
FT                   /db_xref="IMGT/HLA:DRB1*03:31"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Z850"
FT                   /protein_id="ABG56235.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            68..337
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03V"
FT                   /number=2
XX
SQ   Sequence 350 BP; 68 A; 88 C; 127 G; 67 T; 0 other;
     ggcggcgtca ctgtcagtgt cttctcagga ggccgcctgt gtgactggat cgttcgtgtc        60
     cccacagcac gtttcttgga gtactctacg tctgagtgtc atttcttcaa tgggacggag       120
     cgggtgcggt acctggacag atacttccat aaccaggagg agtacgtgcg cttcgacagc       180
     gacgtggggg agtaccgggc ggtgacggag ctggggcggc ctgatgccga gtactggaac       240
     agccagaagg acctcctgga gcagaagcgg ggccgggtgg acaactactg cagacacaac       300
     tacggggttg tggagagctt cacagtgcag cggcgaggtg agcgcggcgc                  350
//


spacer
spacer