spacer

EBI Dbfetch

ID   DQ645957; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   DQ645957;
XX
DT   11-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*25new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Yu M., Hall J.E.III., Hartman K.J., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   "A novel HLA-A*25 allele identified by PCR-SBT in a Caucasian hematopoietic
RT   stem cell donor";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Yu M., Hall J.E.III., Hartman K.J., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   ;
RL   Submitted (19-MAY-2006) to the INSDC.
RL   HLA and Immunogenetics Laboratory, Children's Memorial Hospital, 2300
RL   Children's Plaza, Chicago, IL 60614, USA
XX
DR   MD5; 1d781ce9dfe7458ba41060a502799c4c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: A2F-81-GC, rev_name: A2R-86-G"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q0ZB68"
FT                   /db_xref="IMGT/HLA:A*25:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ZB68"
FT                   /protein_id="ABG54312.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRESLRIALRYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQHKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
XX
SQ   Sequence 787 BP; 144 A; 254 C; 281 G; 108 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagagagc ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccgc       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggcgggg cggggctcgg       480
     gggaccgggc tgacctcggg gtccgggcca ggttctcaca ccatccagag gatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc agcaggacgc ttacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcacaagtg ggagacggcc catgaggcgg agcagtggag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer