Dbfetch

ID   DQ641496; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   DQ641496;
XX
DT   20-JUN-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B-B*0830N
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Hirv K., Skambraks A., Mytilineos J.;
RT   "Characterization of a new HLA-B*08 null allele";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Hirv K., Skambraks A., Mytilineos J.;
RT   ;
RL   Submitted (17-MAY-2006) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstrasse 10, Ulm 89081, Germany
XX
DR   MD5; db5da6e85722874a33969578e1f103e2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-B"
FT                   /allele="B*0830N"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-B"
FT                   /allele="B*0830N"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(<1..270,517..599)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*0830N"
FT                   /product="truncated MHC class I antigen"
FT                   /note="human leucocyte antigen"
FT                   /db_xref="IMGT/HLA:B*08:30N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q155X3"
FT                   /protein_id="ABG23665.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*0830N"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-B"
FT                   /allele="B*0830N"
FT                   /number=3
FT   variation       599
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="compared to HLA-B*080101 allele; introduces
FT                   premature stop codon in HLA-B*08var allele"
XX
SQ   Sequence 792 BP; 145 A; 263 C; 285 G; 99 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgg acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagagcatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag tacgcctaag       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag gacagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacacgc       780
     tggagcgcgc gg                                                           792
//