Dbfetch

ID   DQ535035; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   DQ535035;
XX
DT   13-JUN-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate BY00114 MHC class I antigen (HLA-Cw) gene,
DE   HLA-Cw*050101 variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Lazaro A.M., Xiao Y., Nichol L., Hurley C.K.;
RT   ;
RL   Submitted (10-MAY-2006) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 4946886ad0b2d39fca4ec6625e946055.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00114"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*050101 variant"
FT   mRNA            join(<1..270,517..>791)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*050101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>791)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*050101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*05:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q19A32"
FT                   /protein_id="ABF93213.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIVLNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            <1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*050101 variant"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..>791
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*050101 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 112 A; 167 C; 195 G; 71 T; 246 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgtc ctgaatgagg acctgcgctc ctggaccgcc gcggacaagg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aagaagacgc       780
     tgcagcgcgc g                                                            791
//