spacer

EBI Dbfetch

ID   DQ533486; SV 1; linear; genomic DNA; STD; HUM; 370 BP.
XX
AC   DQ533486;
XX
DT   06-JUN-2006 (Rel. 88, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Homo sapiens isolate KS9504263-DR12V MHC class II antigen (HLA-DRB1) gene,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-370
RX   DOI; 10.1111/j.1744-313X.2008.00785.x.
RX   PUBMED; 19046299.
RA   Lee H.L., Chu C.C., Trejaut J.A., Yang K.L., Lin M.;
RT   "Identification of two novel HLA-DRB1 alleles, HLA-DRB1*1214 and
RT   HLA-DRB1*1215, in two Taiwanese individuals";
RL   Int. J. Immunogenet. 35(6):423-426(2008).
XX
RN   [2]
RP   1-370
RA   Chu C.-C.;
RT   ;
RL   Submitted (08-MAY-2006) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taiwan
XX
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..370
FT                   /organism="Homo sapiens"
FT                   /isolate="KS9504263-DR12V"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>370
FT                   /gene="HLA-DRB1"
FT   mRNA            <101..>370
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <101..>370
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="ABF74752.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEEFLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            101..370
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 370 BP; 68 A; 100 C; 129 G; 73 T; 0 other;
     cagtgcctgc accccaccca gggagccccg gatggtggcg tcgctgtcag tgtcttctca        60
     ggaggccacc tgtgtgactg gatcgttcgt gtccccacag cacgtttctt ggagtactct       120
     acgggtgagt gttatttctt caatgggacg gagcgggtgc ggttactgga gagacacttc       180
     cataaccagg aggagttcct gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg       240
     gagctggggc ggcctgtcgc cgagtcctgg aacagccaga aggacttcct ggaagacagg       300
     cgcgccgcgg tggacaccta ttgcagacac aactacgggg ctgtggagag cttcacagtg       360
     cagcggcgag                                                              370
//


spacer
spacer