spacer

EBI Dbfetch

ID   DQ523225; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   DQ523225;
XX
DT   29-MAY-2006 (Rel. 87, Created)
DT   09-SEP-2010 (Rel. 106, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24 variant allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/j.1399-0039.2006.00663.x.
RX   PUBMED; 16948652.
RA   Lim S., Chen S.H., Ren E.C.;
RT   "Identification of a new HLA-A*2464 variant in the Singapore Chinese
RT   population";
RL   Tissue Antigens 68(3):265-267(2006).
XX
RN   [2]
RP   1-276
RA   Ren E.C., Lim S.F., Chan S.H.;
RT   "Novel human HLA-A alleles identified in potential bone marrow donors";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Ren E.C., Lim S.F., Chan S.H.;
RT   ;
RL   Submitted (02-MAY-2006) to the INSDC.
RL   Microbiology, National University of Singapore, 5 Science Drive 2,
RL   Singapore 117597, Singapore
XX
DR   MD5; 3d5d763bc025419cd91785f41a8c490a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q19KI9"
FT                   /db_xref="IMGT/HLA:A*24:64"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q19KI9"
FT                   /protein_id="ABF67610.1"
FT                   /translation="SHTLQWMIGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=3
XX
SQ   Sequence 276 BP; 56 A; 81 C; 100 G; 39 T; 0 other;
     gttctcacac cctccagtgg atgattggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggacggg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer