spacer

EBI Dbfetch

ID   DQ503425; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ503425;
XX
DT   15-MAY-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*060401 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Nolan K.E., Schiller J.J., Ghosh S., Magnuson V.L.;
RT   "A novel HLA-DQB1*060401 variant in a diabetic family";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Nolan K.E., Schiller J.J., Ghosh S., Magnuson V.L.;
RT   ;
RL   Submitted (19-APR-2006) to the INSDC.
RL   Pediatrics, Medical College of Wisconsin, 8701 Watertown Plank Rd.,
RL   Milwaukee, WI 53226, USA
XX
DR   MD5; 9161e25cffdd2eb8835ac9671af3bf59.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060401 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060401 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060401 variant"
FT                   /product="MHC class II antigen"
FT                   /note="major histocompatibility complex class II DQ beta 1"
FT                   /db_xref="GOA:Q1HCN6"
FT                   /db_xref="IMGT/HLA:DQB1*06:04:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HCN6"
FT                   /protein_id="ABF50985.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060401 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 66 C; 99 G; 44 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacaccgt gtgcagacac aactacgagg       240
     tggggtaccg cgggatcctg cagaggagag                                        270
//


spacer
spacer