Dbfetch

ID   DQ494324; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ494324;
XX
DT   15-MAY-2007 (Rel. 91, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2008.01135.x.
RX   PUBMED; 19000132.
RA   Wang Z., Shan X., Zhang Z.;
RT   "Identification of a novel HLA-DRB allele, HLA-DRB1*1461";
RL   Tissue Antigens 72(6):603-604(2008).
XX
RN   [2]
RP   1-270
RA   Li W., Liu N., Zhang Z., Shan X.;
RT   "A novel DRB1*14 allele identified by SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Li W., Liu N., Zhang Z., Shan X.;
RT   ;
RL   Submitted (15-APR-2006) to the INSDC.
RL   Histocompatibility Laboratory, Beijing Red Cross Blood Center, No. 37
RL   Beisanhuan Zhong Road, Beijing 100088, China
XX
DR   MD5; 9e06a17a20407dd781465e98f3794791.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:61"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="ABF50050.1"
FT                   /translation="RFLEYSTGECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 64 C; 102 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//