Dbfetch

ID   DQ494177; SV 1; linear; genomic DNA; STD; HUM; 934 BP.
XX
AC   DQ494177;
XX
DT   25-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2915 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-934
RX   DOI; 10.1016/j.humimm.2006.07.007.
RX   PUBMED; 17055361.
RA   Gill K.K., Leligdowicz A., Luo M., Bielawny T., Brunham R., Plummer F.A.;
RT   "Identification of four novel HLA-A alleles from an East African population
RT   by high-resolution sequence-based typing";
RL   Hum. Immunol. 67(10):833-838(2006).
XX
RN   [2]
RP   1-934
RA   Gill K.K., Leligdowicz A., Bielawny T., Luo M., Plummer F.A.;
RT   ;
RL   Submitted (14-APR-2006) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 92fec9c411bbef8cf4562074a48c7501.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..934
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>934
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2915"
FT   mRNA            join(<84..353,595..>870)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2915"
FT                   /product="MHC class I antigen"
FT   CDS             join(<84..353,595..>870)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2915"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0EVK1"
FT                   /db_xref="IMGT/HLA:A*29:15"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0EVK1"
FT                   /protein_id="ABF54964.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTLRGYYNQSEAGSHTIQMMYGCHVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADVAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            84..353
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2915"
FT                   /number=2
FT   exon            595..870
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2915"
FT                   /number=3
XX
SQ   Sequence 934 BP; 157 A; 305 C; 341 G; 131 T; 0 other;
     ggggcccgcc cggcggggac gcaggacccg ggtagccgcg ccgggaggag ggtcgggtgg        60
     gtctcagcca ctcctcgccc caggctccca ctccatgagg tatttcacca catccgtgtc       120
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       180
     cgtgcggttt gacagcgacg ccgcgagcca gaggatggag ccgcgggcac cgtggataga       240
     gcaggagggg ccggagtatt gggacctgca gacacggaat gtgaaggccc agtcacagac       300
     tgaccgagcg aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       360
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc gggtcgccca       420
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       480
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       540
     ggtcggggcc ggacggggct cgggggactg ggctgaccgt ggggtcgggg ccaggttctc       600
     acaccatcca gatgatgtat ggctgccacg tggggtcgga cgggcgcttc ctccgcgggt       660
     accggcagga cgcctacgac ggcaaggatt acatcgcctt gaacgaggac ctgcgctctt       720
     ggaccgcggc ggacgtggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg       780
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       840
     agaacgggaa ggagacgctg cagcgcacgg gtaccggggg ccacggggcg cctccctgat       900
     cgcctgtaga tctcccgggc tggcctccca caag                                   934
//