spacer

EBI Dbfetch

ID   DQ494176; SV 1; linear; genomic DNA; STD; HUM; 935 BP.
XX
AC   DQ494176;
XX
DT   25-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2630 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-935
RX   DOI; 10.1016/j.humimm.2006.07.007.
RX   PUBMED; 17055361.
RA   Gill K.K., Leligdowicz A., Luo M., Bielawny T., Brunham R., Plummer F.A.;
RT   "Identification of four novel HLA-A alleles from an East African population
RT   by high-resolution sequence-based typing";
RL   Hum. Immunol. 67(10):833-838(2006).
XX
RN   [2]
RP   1-935
RA   Gill K.K., Leligdowicz A., Bielawny T., Luo M., Plummer F.A.;
RT   ;
RL   Submitted (14-APR-2006) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 15e7bb73fdfc4503ba16eda5f1f5e911.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..935
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>935
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2630"
FT   mRNA            join(<85..354,596..>871)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2630"
FT                   /product="MHC class I antigen"
FT   CDS             join(<85..354,596..>871)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2630"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0EVK0"
FT                   /db_xref="IMGT/HLA:A*26:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0EVK0"
FT                   /protein_id="ABF54963.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTHRVDLGTLRGYYNQSEAGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            85..354
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2630"
FT                   /number=2
FT   exon            596..871
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2630"
FT                   /number=3
XX
SQ   Sequence 935 BP; 159 A; 312 C; 340 G; 124 T; 0 other;
     ggggcccgcc cggcgggggc gcaggacccg ggaagccgcg cctggaggag ggtcgggcgg        60
     gtctcagcca ctcctcgccc ccaggctccc actccatgag gtatttctac acctccgtgt       120
     cccggcccgg ccgcggggag ccccgcttca tcgccgtggg ctacgtggac gacacgcagt       180
     tcgtgcggtt cgacagcgac gccgcgagcc agaggatgga gccgcgggcg ccgtggatag       240
     agcaggaggg gccggagtat tgggaccgga acacacggaa tgtgaaggcc cactcacaga       300
     ctcaccgagt ggacctgggg accctgcgcg gctactacaa ccagagcgag gccggtgagt       360
     gaccccggcc cggggcgcag gtcacgaccc ctcatccccc acggacgggc caggtcgccc       420
     acagtctccg ggtccgagat ccgccccgaa gccgcgggac cccgagaccc ttgccccggg       480
     agaggcccag gcgcctttac ccggtttcat tttcagttta ggccaaaaat ccccccgggt       540
     tggtcggggc ggggcggggc tcgggggacc gggctgacct cggggtccgg gccaggttct       600
     cacaccatcc agaggatgta tggctgcgac gtggggccgg acgggcgctt cctccgcggg       660
     taccagcagg acgcttacga cggcaaggat tacatcgccc tgaacgagga cctgcgctct       720
     tggaccgcgg cggacatggc ggctcagatc acccagcgca agtgggagac ggcccatgag       780
     gcggagcagt ggagagccta cctggagggc cggtgcgtgg agtggctccg cagatacctg       840
     gagaacggga aggagacgct gcagcgcacg ggtaccaggg gccacggggc gcctccctga       900
     tcgcctgtag atctcccggg ctggcctccc acaag                                  935
//


spacer
spacer