Dbfetch

ID   DQ494174; SV 1; linear; genomic DNA; STD; HUM; 935 BP.
XX
AC   DQ494174;
XX
DT   25-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*9202 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-935
RX   DOI; 10.1016/j.humimm.2006.07.007.
RX   PUBMED; 17055361.
RA   Gill K.K., Leligdowicz A., Luo M., Bielawny T., Brunham R., Plummer F.A.;
RT   "Identification of four novel HLA-A alleles from an East African population
RT   by high-resolution sequence-based typing";
RL   Hum. Immunol. 67(10):833-838(2006).
XX
RN   [2]
RP   1-935
RA   Gill K.K., Leligdowicz A., Bielawny T., Luo M., Plummer F.A.;
RT   ;
RL   Submitted (14-APR-2006) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 9959f9571c2a33183210ab916ed0845e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..935
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>935
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9202"
FT   mRNA            join(<85..354,596..>871)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9202"
FT                   /product="MHC class I antigen"
FT   CDS             join(<85..354,596..>871)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9202"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0EVJ8"
FT                   /db_xref="IMGT/HLA:A*02:102"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0EVJ8"
FT                   /protein_id="ABF54961.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASRRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTLQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            85..354
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9202"
FT                   /number=2
FT   exon            596..871
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9202"
FT                   /number=3
XX
SQ   Sequence 935 BP; 162 A; 305 C; 339 G; 129 T; 0 other;
     cgggcccgcc tggcgggggc gcaggacccg ggaagccgcg ccgggaggag ggtcgggcgg        60
     gtctcagcca ctcctcgtcc ccaggctctc actccatgag gtatttcttc acatccgtgt       120
     cccggcccgg ccgcggggag ccccgcttca tcgcagtggg ctacgtggac gacacgcagt       180
     tcgtgcggtt cgacagcgac gccgcgagcc ggaggatgga gccgcgggcg ccgtggatag       240
     agcaggaggg tccggagtat tgggacgggg agacacggaa agtgaaggcc cactcacaga       300
     ctcaccgagt ggacctgggg accctgcgcg gctactacaa ccagagcgag gccggtgagt       360
     gaccccggcc cggggcgcag gtcacgacct ctcatccccc acggacgggc caggtcgccc       420
     acagtctccg ggtccgagat ccgccccgaa gccgcgggac cccgagaccc ttgccccggg       480
     agaggcccag gcgcctttac ccggtttcat tttcagttta ggccaaaaat ccccccaggt       540
     tggtcggggc ggggcggggc tcgggggacc gggctgaccg cggggtccgg gccaggttct       600
     cacaccctcc agaggatgta tggctgcgac gtggggtcgg actggcgctt cctgcgcggg       660
     taccaccagt acgcctacga cggcaaggat tacatcgccc tgaaagagga cctgcgctct       720
     tggaccgcgg cggacatggc agctcagacc accaagcaca agtgggaggc ggcccatgtg       780
     gcggagcagt ggagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg       840
     gagaacggga aggagacgct gcagcgcacg ggtaccaggg gccacggggc gcctccctga       900
     tcgcctgtag atctcccggg ctggcctccc acaag                                  935
//