spacer

EBI Dbfetch

ID   DQ485737; SV 1; linear; genomic DNA; STD; HUM; 828 BP.
XX
AC   DQ485737;
XX
DT   09-MAY-2006 (Rel. 87, Created)
DT   05-DEC-2010 (Rel. 107, Last updated, Version 4)
XX
DE   Homo sapiens isolate A2V_K9503143 MHC class I antigen (HLA-A) gene, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-828
RX   DOI; 10.1111/j.1744-313X.2006.00642.x.
RX   PUBMED; 17284222.
RA   Chu C.C., Lee H.L., Lin M.;
RT   "A novel HLA-A2 variant, A*9203, identified by sequence-based typing";
RL   Int. J. Immunogenet. 34(1):13-15(2007).
XX
RN   [2]
RP   1-828
RA   Chu C.-C.;
RT   "A novel HLA_A allele found in Taiwan";
RL   Unpublished.
XX
RN   [3]
RP   1-828
RA   Chu C.-C.;
RT   ;
RL   Submitted (07-APR-2006) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taiwan
XX
DR   MD5; 8c4ec81ad40f9917361e77c7164d4dff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..828
FT                   /organism="Homo sapiens"
FT                   /isolate="A2V_K9503143"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>828
FT                   /gene="HLA-A"
FT   mRNA            join(<21..290,532..>807)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<21..290,532..>807)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q1HHB9"
FT                   /db_xref="IMGT/HLA:A*02:103"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HHB9"
FT                   /protein_id="ABF29706.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTHRVDLGTLRGYYNQSEAGSHTVQRMCGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            21..290
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            532..807
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 828 BP; 150 A; 267 C; 294 G; 117 T; 0 other;
     cagccactcc tcgtccccag gctctcactc catgaggtat ttcttcacat ccgtgtcccg        60
     gcccggccgc ggggagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt       120
     gcggttcgac agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca       180
     ggaggggccg gagtattggg accaggagac acggaatgtg aaggcccagt cacagactca       240
     ccgagtggac ctggggaccc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc       300
     ccggcccggg gcgcaggtca cgacctctca tcccccacgg acgggccagg tcgcccacag       360
     tctccgggtc cgagatccgc cccgaagccg cgggaccccg agacccttgc cccgggagag       420
     gcccaggcgc ctttacccgg tttcattttc agtttaggcc aaaaatcccc ccaggttggt       480
     cggggcgggg cggggctcgg gggaccgggc tgaccgcggg gtccgggcca ggttctcaca       540
     ccgtccagag gatgtgtggc tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc       600
     accagtacgc ctacgacggc aaggattaca tcgccctgaa agaggacctg cgctcttgga       660
     ccgcggcgga catggcagct cagaccacca agcacaagtg ggaggcggcc catgtggcgg       720
     agcagttgag agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga       780
     acgggaagga gacgctgcag cgcacgggta ccaggggcca cggggcgc                    828
//


spacer
spacer