spacer

EBI Dbfetch

ID   DQ485722; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   DQ485722;
XX
DT   13-MAY-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*010104 allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RX   DOI; 10.1111/j.1399-0039.2006.00642.x.
RX   PUBMED; 16948651.
RA   Yu M., Hall J.E.III., Hartman K., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   "A novel human leukocyte antigen-A*01 allele, A*010104, identified by
RT   polymerase chain reaction-sequence-based typing in a Caucasian
RT   hematopoietic stem cell donor";
RL   Tissue Antigens 68(3):263-263(2006).
XX
RN   [2]
RP   1-787
RA   Yu M., Hall J.E.III., Hartman K., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   ;
RL   Submitted (07-APR-2006) to the INSDC.
RL   Histocompatibility and Immunogenetics Laboratory, Children's Memorial
RL   Hospital, 2300 Children's Plaza, Chicago, IL 60614, USA
XX
DR   MD5; 90267d2602bac8fbb871702030a2c991.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000265434; homo_sapiens.
DR   Ensembl-Tr; ENST00000416096; homo_sapiens.
DR   Ensembl-Tr; ENST00000417978; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000442939; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000444289; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   Ensembl-Tr; ENST00000579721; homo_sapiens.
DR   Ensembl-Tr; ENST00000583265; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="from the German registry for stem cell
FT                   donors"
FT                   /note="PCR_primers=fwd_name: Ain1G, rev_name: Ain3.62.M13R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*010104"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*010104"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*010104"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q1HHC0"
FT                   /db_xref="IMGT/HLA:A*01:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HHC0"
FT                   /protein_id="ABF47209.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*010104"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*010104"
FT                   /number=3
XX
SQ   Sequence 787 BP; 146 A; 248 C; 282 G; 111 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaat ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggactccg agacccttgt cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggcgggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggtc catgcggcgg agcagcggag agtctacctg       720
     gagggccggt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer