spacer

EBI Dbfetch

ID   AH015789; SV 2; linear; genomic DNA; STD; HUM; 1021 BP.
XX
AC   AH015789; DQ438173-DQ438175;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*68 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1021
RA   Aubrey M.T., Offord L.L., Freed B.M.;
RT   "A new HLA-A68 allele demonstrating the perils of type III sequencing
RT   ambiguities";
RL   Unpublished.
XX
RN   [2]
RP   1-1021
RA   Aubrey M.T., Offord L.L., Freed B.M.;
RT   ;
RL   Submitted (07-MAR-2006) to the INSDC.
RL   ClinImmune Labs, Ste 300, 12635 E. Montview Blvd, Aurora, CO 80045, USA
XX
DR   MD5; e4fbba98e31de8fc4a13847d28a7128a.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:90819587, gi:90819588, gi:90819589, gi:90819586.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1021
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT   mRNA            join(<1..270,371..646,747..>1021)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1021)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /product="MHC class I antigen"
FT                   /note="histocompatibility protein"
FT                   /db_xref="GOA:Q1W4D6"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1W4D6"
FT                   /protein_id="ABD98442.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..>1021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /number=4
XX
SQ   Sequence 1021 BP; 170 A; 246 C; 283 G; 122 T; 200 other;
     gctcccactc catgaggtat ttctacactt ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg catatgactc accacgctgt       780
     ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     g                                                                      1021
//


spacer
spacer