Dbfetch

ID   DQ417689; SV 1; linear; genomic DNA; STD; HUM; 2679 BP.
XX
AC   DQ417689;
XX
DT   20-MAR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2679
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequence of new HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-2679
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (24-FEB-2006) to the INSDC.
RL   Histocompatibility, CTM, Avenida De La Democracia, Madrid 28032, Spain
XX
DR   MD5; 903ee9df10f0d32a9273ef5ba863b636.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2679
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2679
FT                   /gene="HLA-B"
FT   mRNA            join(<1..73,202..471,718..993,1568..1843,1937..2053,
FT                   2495..2527,2636..>2679)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,718..993,1568..1843,1937..2053,
FT                   2495..2527,2636..2679)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="histocompatibility antigen"
FT                   /db_xref="GOA:Q1ZZH2"
FT                   /db_xref="IMGT/HLA:B*08:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ZZH2"
FT                   /protein_id="ABD75758.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LHGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   gap             74..201
FT                   /estimated_length=128
FT   gap             472..717
FT                   /estimated_length=246
FT   gap             994..1567
FT                   /estimated_length=574
FT   gap             1844..1936
FT                   /estimated_length=93
FT   gap             2054..2494
FT                   /estimated_length=441
FT   gap             2528..2635
FT                   /estimated_length=108
XX
SQ   Sequence 2679 BP; 222 A; 337 C; 360 G; 170 T; 1590 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn ngctcccact ccatgaggta tttcgacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatctt caagaccaac acacagactg       420
     accgagagag cctgcggaac ctgcacggct actacaacca gagcgaggcc gnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnggt       720
     ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca ggacagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggacacg ctggagcgcg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat gggnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct      1980
     ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg      2040
     aggaagagct cagnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngtggaa aaggagggag ctactctcag      2520
     gctgcgtnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2580
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcagc      2640
     gacagtgccc agggctctga tgtgtctctc acagcttga                             2679
//