Dbfetch

ID   AH015664; SV 2; linear; genomic DNA; STD; HUM; 635 BP.
XX
AC   AH015664; DQ390459-DQ390460;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens clone 12973 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*14XX allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-635
RX   DOI; 10.1111/j.1399-0039.2006.00669.x.
RX   PUBMED; 17026471.
RA   Chen Q., Zou H., Xu X.H., Luo M., Wang J., Zuo Y.Q., Chen Y.H., Chen X.H.,
RA   Chen X.L., Yao Z.Q., Song N., Zeng J., Mi X.Y., Sun S.X., Wang J.X.,
RA   Zhao T.M.;
RT   "Characterization of HLA-B*5516, -B*1313, -B*9512, and -DRB1*1457 alleles
RT   identified in a southwest Chinese population";
RL   Tissue Antigens 68(4):339-343(2006).
XX
RN   [2]
RP   1-635
RA   Chen Q., Zou H., Xu X.-H., Zuo Y.-Q., Luo M., Chen X.-H., Chen Y.-H.,
RA   Song N., Chen X.-L., Yao Z.-Q., Mi X.-Y., Wang J.-X., Zhao T.-M.;
RT   "Identification of a novel HLA-DRB1 allele (DRB1*14XX) with a DRB1*04
RT   sequence motif";
RL   Unpublished.
XX
RN   [3]
RP   1-635
RA   Chen Q., Zou H., Xu X.-H., Zuo Y.-Q., Luo M., Chen X.-H., Chen Y.-H.,
RA   Song N., Chen X.-L., Yao Z.-Q., Mi X.-Y., Wang J.-X., Zhao T.-M.;
RT   ;
RL   Submitted (06-FEB-2006) to the INSDC.
RL   MCIGS, NIAID, National Institutes of Health, Bldg#50, Rm 5511, 50 South
RL   Dr., Bethesda, MD 20892, USA
XX
DR   MD5; 634c914d23b2d173c8449dd3639cd52f.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:89059019, gi:89059020, gi:89059018.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..635
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="12973"
FT                   /db_xref="taxon:9606"
FT   gene            1..551
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT   mRNA            1..>115
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT   5'UTR           1..15
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT   CDS             16..>115
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT                   /note="leucocyte antigen"
FT                   /protein_id="ABD60300.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTR"
FT   exon            16..115
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /number=1
FT   gap             148..247
FT                   /estimated_length=unknown
FT   mRNA            <270..>551
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT   CDS             <270..>551
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT                   /note="leucocyte antigen"
FT                   /protein_id="ABD60301.1"
FT                   /translation="HPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKT
FT                   GVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEW"
FT   exon            270..551
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /number=3
XX
SQ   Sequence 635 BP; 110 A; 146 C; 145 G; 134 T; 100 other;
     gtcctgttct ccagcatggt gtgtctgagg ctccctggag gctcctgcat ggcagttctg        60
     acagtgacac tgatggtgct gagctcccca ctggctttgg ctggggacac cagacgtaag       120
     tgcacattgt gggtgctgag ctactatnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     nnnnnnnccc tctacctttt ttctcctagt ccatcctaag gtgactgtgt atccttcaaa       300
     gacccagccc ctgcagcacc acaacctgct ggtctgttct gtgagtggtt tctatccagg       360
     cagcattgaa gtcaggtggt tccggaatgg ccaggaagag aagactgggg tggtgtccac       420
     aggcctgatc cacaatggag actggacctt ccagaccctg gtgatgctgg aaacagttcc       480
     tcggagtgga gaggtttaca cctgccaagt ggagcaccca agcgtgacaa gccctctcac       540
     agtggaatgg agtgagcagc tttctgactt cataaatttc tcacccacca agaaggggac       600
     tgtgctcatc cctgagtgtc aggtttctcc tctcc                                  635
//