spacer

EBI Dbfetch

ID   DQ386161; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   DQ386161;
XX
DT   02-MAR-2006 (Rel. 87, Created)
DT   10-MAY-2012 (Rel. 112, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*02 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Cordovado S.K., Hancock L.N., Mueller P.W.;
RT   "Identification of a novel DPB1 allele by sequence-based typing in the
RT   GoKinD population";
RL   Unpublished.
XX
RN   [2]
RP   1-264
RA   Hancock L.N., Cordovado S.K., Mueller P.W.;
RT   ;
RL   Submitted (01-FEB-2006) to the INSDC.
RL   DLS/MBB/DMRAS, Centers for Disease Control and Prevention, 4770 Buford Hwy.
RL   MS F-50, Atlanta, GA 30341, USA
XX
DR   MD5; 37edb21487cb63e15b0916fce64166f9.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
DR   IMGT/LIGM; DQ386161.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02"
FT                   /product="MHC class II antigen"
FT                   /note="MHC class II HLA-DP-beta chain; binds to T cell
FT                   receptor"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*115:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="ABD36812.1"
FT                   /translation="NYLFQGRQECYTFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02"
FT                   /number=2
FT   variation       36
FT                   /gene="HLA-DPB1"
FT                   /replace="g"
FT                   /note="results in threonine to alanine substitution in
FT                   HLA-DPB1*020102"
XX
SQ   Sequence 264 BP; 62 A; 64 C; 97 G; 41 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacacgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer