Dbfetch

ID   DQ343835; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   DQ343835;
XX
DT   25-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11V allele, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RX   DOI; 10.1111/j.1399-0039.2006.00658.x.
RX   PUBMED; 16948650.
RA   Chu C.-C., Lee H.-L., Lin M.;
RT   "A*1126: a novel HLA-A11 variant identified by sequence-based typing
RT   method";
RL   Tissue Antigens 68(3):263-265(2006).
XX
RN   [2]
RP   1-787
RA   Chu C.-C.;
RT   ;
RL   Submitted (28-DEC-2005) to the INSDC.
RL   Medical Research, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 2ec303a82ce2b65d5b28d72c3f20d21f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11V"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*11:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L9H3"
FT                   /protein_id="ABC70993.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQMMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11V"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11V"
FT                   /number=3
XX
SQ   Sequence 787 BP; 144 A; 248 C; 285 G; 110 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccagg tggcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg cagggcttgg       480
     gggactgggc tgaccgtggg gtcggggcca ggttctcaca ccatccagat gatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggcc catgcggcgg agcagcagag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//