spacer

EBI Dbfetch

ID   DQ343834; SV 1; linear; genomic DNA; STD; HUM; 487 BP.
XX
AC   DQ343834;
XX
DT   25-JAN-2006 (Rel. 86, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12V allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-487
RX   DOI; 10.1111/j.1744-313X.2008.00785.x.
RX   PUBMED; 19046299.
RA   Lee H.L., Chu C.C., Trejaut J.A., Yang K.L., Lin M.;
RT   "Identification of two novel HLA-DRB1 alleles, HLA-DRB1*1214 and
RT   HLA-DRB1*1215, in two Taiwanese individuals";
RL   Int. J. Immunogenet. 35(6):423-426(2008).
XX
RN   [2]
RP   1-487
RA   Chu C.-C.;
RT   ;
RL   Submitted (27-DEC-2005) to the INSDC.
RL   Medical Research, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; eedff3b90d3dfdb521c9f2e1150b94e2.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..487
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>487
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12V"
FT   mRNA            <209..>478
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12V"
FT                   /product="MHC class II antigen"
FT   CDS             <209..>478
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12V"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="ABC70992.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEEFVRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            209..478
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12V"
FT                   /number=2
XX
SQ   Sequence 487 BP; 81 A; 132 C; 178 G; 96 T; 0 other;
     gtggttttcc cgcctggtcc cccaggcccc cgttcgcctc aggaagacgg aggatgagct        60
     cctgggctgc aggtggtggg cgttgcgggt ggggccggtt aaggttccca gtgcctgcac       120
     cccacccagg gagccccgga tggtggcgtc gctgtcagtg tcttctcagg aggccacctg       180
     tgtgactgga tcgttcgtgt ccccacagca cgtttcttgg agtactctac gggtgagtgt       240
     tatttcttca atgggacgga gcgggtgcgg ttactggaga gacacttcca taaccaggag       300
     gagttcgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga gctggggcgg       360
     cctgtcgccg agtcctggaa cagccagaag gacatcctgg aagacaggcg cgccgcggtg       420
     gacacctatt gcagacacaa ctacggggct gtggagagct tcacagtgca gcggcgaggt       480
     gagcgcg                                                                 487
//


spacer
spacer