Dbfetch

ID   DQ343759; SV 1; linear; genomic DNA; STD; HUM; 789 BP.
XX
AC   DQ343759;
XX
DT   01-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4447 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-789
RA   Klinker E., Hirv K., Mytilineos J.;
RT   "Characterization of a new HLA-B*44 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-789
RA   Klinker E., Hirv K., Mytilineos J.;
RT   ;
RL   Submitted (27-DEC-2005) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstrasse 10, Ulm 89081, Germany
XX
DR   MD5; f099056a0ac2cb22ac35aef7dfe052b2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..789
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4447"
FT   mRNA            join(<1..270,514..>789)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4447"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4447"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*44:47"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q2I2S9"
FT                   /protein_id="ABC84219.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4447"
FT                   /number=2
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4447"
FT                   /number=3
FT   variation       708..710
FT                   /gene="HLA-B"
FT                   /replace="gac"
FT                   /note="compared to HLA-B*4420 allele"
XX
SQ   Sequence 789 BP; 142 A; 263 C; 280 G; 104 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     gggggacggt gctgaccgcg gggccggggc cagggtctca cacttggcag acgatgtatg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcct gtgcgtggag tcgctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcgg                                                               789
//