spacer

EBI Dbfetch

ID   AH015506; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH015506; DQ333354-DQ333355;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24020101 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Hur S.S., Lee M.N., Park S.Y., Kwon O.J.;
RT   ;
RL   Submitted (15-DEC-2005) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
DR   MD5; ddc95c05f1675ee789be22de1b6bac50.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:84514218, gi:84514219, gi:84514217.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24020101"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24020101"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24020101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q2MJA5"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2MJA5"
FT                   /protein_id="ABC59116.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24020101"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24020101"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 165 C; 193 G; 76 T; 100 other;
     GCTCCCACTC CATGAGGTAT TTCTCCACAT CCGTGTCCCG GCCCGGCCGC GGGGAGCCCC        60
     GCTTCATCGC CGTGGGCTAC GTGGACGACA CGCAGTTCGT GCGGTTCGAC AGCGACGCCG       120
     CGAGCCAGAG GATGGAGCCG CGGGCGCCGT GGATAGAGCA GGAGGGGCCG GAGTATTGGG       180
     ACGAGGAGAC AGGGAAAGTG AAGGCCCACT CACAGACTGA CCGAGAGAAC CTGCGGATCG       240
     CGCTCCGCTA CTACAACCAG AGCGAGGCCG NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       300
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       360
     NNNNNNNNNN GTTCTCACAC CCTCCAGATG ATGTTTGGCT GCGACGTGGG GTCGGACGGA       420
     CGCTTCCTCC GCGGGTACCA CCAGTACGCC TACGACGGCA AGGATTACAT CGCCCTGAAA       480
     GAGGACCTGC GCTCTTGGAC CGCGGCGGAC ATGGCGGCTC AGATCACCAA GCGCAAGTGG       540
     GAGGCGGCCC ATGTGGCGGA GCAGCAGAGA GCCTACCTGG AGGGCACGTG CGTGGACGGG       600
     CTCCGCAGAT ACCTGGAGAA CGGGAAGGAG ACGCTGCAGC GCACGG                      646
//



spacer
spacer