spacer

EBI Dbfetch

ID   DQ321673; SV 1; linear; genomic DNA; STD; HUM; 2722 BP.
XX
AC   DQ321673;
XX
DT   31-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35 novel allele, exons
DE   1 through 6 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2722
RX   DOI; 10.1111/j.1399-0039.2007.00882.x.
RX   PUBMED; 17661920.
RA   Lee K.W.;
RT   "A novel hybrid allele (B*3563) originated from B*350101 and B*4001-like
RT   alleles";
RL   Tissue Antigens 70(3):260-262(2007).
XX
RN   [2]
RP   1-2722
RA   Lee K.W.;
RT   ;
RL   Submitted (12-DEC-2005) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; 4b2073d7a81cc5f693a0c4b29f1309bc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2722
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="B05-2224"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2722
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT   mRNA            join(<1..227,357..626,872..1147,1723..1998,2103..2219,
FT                   2661..>2693)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /product="MHC class I antigen"
FT   exon            <1..227
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /number=1
FT   5'UTR           <1..154
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT   CDS             join(155..227,357..626,872..1147,1723..1998,2103..2219,
FT                   2661..>2693)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A1XAM5"
FT                   /db_xref="IMGT/HLA:B*35:63"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1XAM5"
FT                   /protein_id="ABC40678.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAA"
FT   exon            357..626
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /number=2
FT   exon            872..1147
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /number=3
FT   exon            1723..1998
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /number=4
FT   exon            2103..2219
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /number=5
FT   exon            2661..2693
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 novel"
FT                   /number=6
XX
SQ   Sequence 2722 BP; 512 A; 807 C; 868 G; 535 T; 0 other;
     tgtcgggtcc ttcttccagg atactcgtga cgcgtcccca tttcccactc ccattgggtg        60
     tcggatatct agagaagcca atcagtgtcg ccggggtccc agttctaaag tccccacgca       120
     cccacccgga ctcagaatct cctcagacgc cgagatgcgg gtcacggcgc cccgaaccgt       180
     cctcctgctg ctctgggggg cagtggccct gaccgagacc tgggccggtg agtgcggggt       240
     cgggagggaa atggcctctg tggggaggag cgaggggacc gcaggcgggg gcgcaggacc       300
     tgaggagccg cgccgggagg agggtcgggc gggtctcagc ccctcctcgc ccccaggctc       360
     ccactccatg aggtatttcc acaccgccat gtcccggccc ggccgcgggg agccccgctt       420
     catcaccgtg ggctacgtgg acgacacgct gttcgtgagg ttcgacagcg acgccacgag       480
     tccgaggaag gagccgcggg cgccatggat agagcaggag gggccggagt attgggaccg       540
     ggagacacag atctccaaga ccaacacaca gacttaccga gagagcctgc ggaacctgcg       600
     cggctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc aggtcacgac       660
     tccccatccc ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag atccgcctcc       720
     ctgaggccgc gggacccgcc cagaccctcg accggcgaga gccccaggcg cgtttacccg       780
     gtttcatttt cagttgaggc caaaatcccc gcgggttggt cggggcgggg cggggctcgg       840
     gggacggggc tgaccgcggg gccggggcca gggtctcaca tcatccagag gatgtatggc       900
     tgcgacctgg ggcccgacgg gcgcctcctc cgcgggcatg accagtccgc ctacgacggc       960
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga caccgcggct      1020
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag agcctacctg      1080
     gagggcctgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag      1140
     cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg ccggggatgg      1200
     cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct cccttgaatg      1260
     gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct ctaggacaat      1320
     taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata ctgatcaggg      1380
     gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca ggccttgttc      1440
     tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt cactttacct      1500
     ccactcagat caggagcaga agtccctgtt ccccgctcag agactcgaac tttccaatga      1560
     ataggagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt gccccttccc      1620
     cacaccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag ggtgtcccat      1680
     gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca aagacacacg      1740
     tgacccacca ccccgtctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct      1800
     accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact caggacactg      1860
     agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca gctgtggtgg      1920
     tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg ctgccgaagc      1980
     ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc tcagggaaag      2040
     caggagccct tctggagccc ttcagcaggg tcagggcccc tcgtcttccc ctcctttccc      2100
     agagccatct tcccagtcca ccatccccat cgtgggcatt gttgctggcc tggctgtcct      2160
     agcagttgtg gtcatcggag ctgtggtcgc tactgtgatg tgtaggagga agagctcagg      2220
     tagggaaggg gtgaggggtg gggtctgggt tttcttgtcc cactgggggt ttcaagcccc      2280
     aggtagaagt gttccctgcc tcattactgg gaagcagcat ccacacaggg gctaacgcag      2340
     cctgggaccc tgtgtgccag cacttactct tttgtgcagc acatgtgaca atgaaggacg      2400
     gatgtatcac cttgatggtt gtggtgttgg ggtcctgatt tcagcattca tgagtcaggg      2460
     gaaggtccct gctaaggaca gaccttagga gggcagttgg tccaggaccc acacttgctt      2520
     tcctcgtgtt tcctgatcct gccttgggtc tgtagtcata cttctggaaa ttccttttgg      2580
     gtccaagacg aggaggttcc tctaagatct catggccctg cttcctccca gtcccctcac      2640
     aggacatttt cttcccacag gtggaaaagg agggagctac tctcaggctg cgtgtaagtg      2700
     gtgggggtgg gagtgtggag ga                                               2722
//


spacer
spacer