spacer

EBI Dbfetch

ID   DQ314861; SV 1; linear; genomic DNA; STD; HUM; 898 BP.
XX
AC   DQ314861;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*m1270 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-898
RX   DOI; 10.1016/j.humimm.2006.03.021.
RX   PUBMED; 16720218.
RA   Keynan Y., Luo M., Lacap P., Brunham R., Plummer F.A.;
RT   "Identification of two novel HLA-C alleles, Cw*070105 and Cw*1408, from
RT   East African women";
RL   Hum. Immunol. 67(4-5):359-362(2006).
XX
RN   [2]
RP   1-898
RA   Keynan Y., Lacap P., Luo M., Brunham R., Plummer F.A.;
RT   ;
RL   Submitted (02-DEC-2005) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 133e28cc9eac121b6ad57497cd2c893b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..898
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>898
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*m1270"
FT   mRNA            join(<69..338,584..>859)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*m1270"
FT                   /product="MHC class I antigen"
FT   CDS             join(<69..338,584..>859)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*m1270"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q0ZP94"
FT                   /db_xref="IMGT/HLA:C*14:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ZP94"
FT                   /protein_id="ABC47333.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIPQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            69..338
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*m1270"
FT                   /number=2
FT   exon            584..859
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*m1270"
FT                   /number=3
XX
SQ   Sequence 898 BP; 155 A; 295 C; 328 G; 120 T; 0 other;
     gggcgcagga cccggggagc cgcgcaggga ggagggtcgg gcgggtctca gccactcctc        60
     gtccccaggc tcccactcca tgaggtattt ctccacatcc gtgtcccggc ccggccgcgg       120
     ggagccccgc ttcatcgcag tgggctacgt ggacgacacg cagttcgtgc ggttcgacag       180
     cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg gtggagcagg aggggccgga       240
     gtattgggac cgggagacac agaagtacaa gcgccaggca cagactgacc gagtgagcct       300
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       360
     gcaggtcacg acccctcccc atcccccacg gacggcccgg gtcgccccaa gtctcccggt       420
     ctgagatcca ccccgaggct gcggaacccg cccagaccct cgaccggaga gagccccagt       480
     cacctttacc cggtttcatt ttcagtttag gccaaaatcc ccgcgggttg gtcggggcgg       540
     ggcggggctc gggggacggg gctgaccgcg ggggcggggc cagggtctca catcccccag       600
     aggatgtatg gctgcgacgt ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       660
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       720
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       780
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgaa gaatgggaag       840
     gagacgctgc agcgcgcggg taccaggggc agtggggagc cttccccatc tcctgtag         898
//


spacer
spacer