Dbfetch

ID   DQ314860; SV 1; linear; genomic DNA; STD; HUM; 926 BP.
XX
AC   DQ314860;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*1954 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-926
RX   DOI; 10.1016/j.humimm.2006.03.021.
RX   PUBMED; 16720218.
RA   Keynan Y., Luo M., Lacap P., Brunham R., Plummer F.A.;
RT   "Identification of two novel HLA-C alleles, Cw*070105 and Cw*1408, from
RT   East African women";
RL   Hum. Immunol. 67(4-5):359-362(2006).
XX
RN   [2]
RP   1-926
RA   Keynan Y., Lacap P., Luo M., Brunham R., Plummer F.A.;
RT   ;
RL   Submitted (02-DEC-2005) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; fe1ee7d13d8cbe7dfeb33bfabe3d8cac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..926
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>926
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1954"
FT   mRNA            join(<69..338,589..>864)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1954"
FT                   /product="MHC class I antigen"
FT   CDS             join(<69..338,589..>864)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1954"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*07:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ZP95"
FT                   /protein_id="ABC47332.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            69..338
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1954"
FT                   /number=2
FT   exon            589..864
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*1954"
FT                   /number=3
XX
SQ   Sequence 926 BP; 155 A; 313 C; 334 G; 124 T; 0 other;
     gggcgcagga cccggggagc cgcgcaggga ggtgggtcgg gcgggtctca gcccctcctc        60
     gcccccaggc tcccactcca tgaggtattt cgacaccgcc gtgtcccggc ccggccgcgg       120
     agagccccgc ttcatctcag tgggctacgt ggacgacacg cagttcgtgc ggttcgacag       180
     cgacgccgcg agtccgagag gggagccgcg ggcgccgtgg gtggagcagg aggggccgga       240
     gtattgggac cgggagacac agaactacaa gcgccaggca caggctgacc gagtgagcct       300
     gcggaacctg cgcggctact acaaccagag cgaggacggt gagtgacccc ggcccggggc       360
     gcaggtcacg acccctcccc atcccccacg gacggcccgg gtcgccccga gtctccccgt       420
     ctgagatcca ccccaaggtg gatctgcgga acccgcccag accctcgacc ggagagagcc       480
     ccagtcgcct ttacccggtt tcattttcgg tttaggccaa aatccccgcg ggttggtcgg       540
     ggcggggcgg ggctcggggg actgggctga ccgcgggggc ggggccaggg tctcacaccc       600
     tccagaggat gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggtatgacc       660
     agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc tcctggaccg       720
     ccgcggacac cgcggctcag atcacccagc gcaagttgga ggcggcccgt gcggcggagc       780
     agctgagagc ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg       840
     ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta       900
     tagatctccc gggatggcct cccacg                                            926
//