spacer

EBI Dbfetch

ID   DQ311653; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ311653;
XX
DT   19-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*02 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Garino E., Berrino M., Bertinetto F., Brancatello F., Caropreso P.,
RA   Chidichimo R., Frisaldi E., Mazzola G., Panniello M., Tondat F.,
RA   Locatelli F., Amoroso A.;
RT   "New HLA-DRB3*02 allelic variant identified by high resolution
RT   sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Garino E., Berrino M., Bertinetto F., Brancatello F., Caropreso P.,
RA   Chidichimo R., Frisaldi E., Mazzola G., Panniello M., Tondat F.,
RA   Locatelli F., Amoroso A.;
RT   ;
RL   Submitted (01-DEC-2005) to the INSDC.
RL   Dept. of Genetic, Biology and Biochemistry, University of Turin, Via
RL   Santena, 19, Turin 10126, Italy
XX
DR   MD5; 4462120e3fe27fc4bba6ad23fa9facc8.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3-p21.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT                   /product="MHC class II antigen"
FT                   /note="similar to DRB3*0207 and to DRB3*0209"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:21"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="ABC33924.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 100 G; 49 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer