spacer

EBI Dbfetch

ID   DQ309438; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ309438;
XX
DT   10-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*02 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2006.00712.x.
RX   PUBMED; 17176451.
RA   Curcio M., Fornaciari S., Mariotti M.L., Presciuttini S., Scatena F.;
RT   "Identification of a novel HLA-DRB3 allele, DRB3*020205, by sequence-based
RT   typing";
RL   Tissue Antigens 68(6):533-534(2006).
XX
RN   [2]
RP   1-270
RA   Curcio M., Mariotti M.L., Fornaciari S., Chelazzi S., Scatena F.;
RT   ;
RL   Submitted (29-NOV-2005) to the INSDC.
RL   Immunoematologia II, Azienda Ospedaliera Universitaria Pisana, via
RL   Paradisa, 2, Pisa, Pi 56124, Italy
XX
DR   MD5; c4ccfc725c3b5c63beb219ea4c98c4d3.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q2F6I0"
FT                   /db_xref="IMGT/HLA:DRB3*02:02:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q2F6I0"
FT                   /protein_id="ABC40506.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02 variant"
FT                   /number=2
FT   variation       45
FT                   /gene="HLA-DRB3"
FT                   /note="polymorphism; synonymous mutation"
XX
SQ   Sequence 270 BP; 59 A; 62 C; 99 G; 50 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gtgagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer