spacer

EBI Dbfetch

ID   DQ241733; SV 1; linear; genomic DNA; STD; HUM; 3283 BP.
XX
AC   DQ241733;
XX
DT   08-NOV-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1518V allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3283
RA   Sanchez-Gordo F., Prat I., Vicario J.L., Alonso-Nieto M.;
RT   "New HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3283
RA   Sanchez-Gordo F., Prat I., Vicario J.L., Alonso-Nieto M.;
RT   ;
RL   Submitted (13-OCT-2005) to the INSDC.
RL   Histocompatibility, Centro de Transfusion de Madrid, Av de la Democracia
RL   s/n, Madrid 28032, Spain
XX
DR   MD5; 80b9c94caa804a2bd7f2447b9d24cf82.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3283
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <232..>2920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT   mRNA            join(<232..304,434..703,949..1224,1800..2075,2180..2296,
FT                   2738..2770,2877..>2920)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /product="MHC class I antigen"
FT   CDS             join(232..304,434..703,949..1224,1800..2075,2180..2296,
FT                   2738..2770,2877..2920)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q306W0"
FT                   /db_xref="IMGT/HLA:B*15:108"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q306W0"
FT                   /protein_id="ABB51135.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRTYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <232..304
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=1
FT   exon            434..703
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=2
FT   exon            949..1224
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=3
FT   exon            1800..2075
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=4
FT   exon            2180..2296
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=5
FT   exon            2738..2770
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=6
FT   exon            2877..>2920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518V"
FT                   /number=7
XX
SQ   Sequence 3283 BP; 609 A; 953 C; 1029 G; 692 T; 0 other;
     agagccttgt ctgcattggg gaggcgcagc gttggggatt ccccactccc acgagtttca        60
     cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc gtccccattt       120
     cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg gggtcccagt       180
     tctaaagtcc ccacgcaccc acccggactc aaaatctcct cagacgccga gatgcgggtc       240
     acggcgcccc gaaccgtcct cctgctgctc tcgggagccc tggccctgac cgagacctgg       300
     gccggtgagt gcggggtcgg cagggaaatg gcctctgtgg ggaggagcga ggggaccgca       360
     ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc       420
     tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       480
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc       540
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       600
     ccggagtatt gggaccggaa cacacagatc tgcaagacca acacacagac ttaccgagag       660
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggcct       720
     ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc gagtctccgg       780
     gtccgagatc cgcccccctg aggccgcggg acccgcccaa accctcgacc ggcgagagcc       840
     ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg       900
     ggcggggcgg ggctcggggg acggggctga ccgcggggcc tgggccaggg tctcacaccc       960
     tccagaggat gtacggctgc gacgtggggc cggacgggcg cctcctccgc gggcatgacc      1020
     agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg      1080
     cggcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt gaggcggagc      1140
     agctgagaac ctacctggag ggcctgtgcg tggagtggct ccgcagatac ctggagaacg      1200
     ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta      1260
     taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag cgctagaatg      1320
     tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg agggccccct      1380
     cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga agacagtccc      1440
     taggatagtg atcaggggtc ccctttgacc cctgcagcag ccttgggaac cgtgactttt      1500
     cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga ttccagcact      1560
     tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc cgctcagaga      1620
     ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc tggtgtctgg      1680
     gttctgtgcc ccttccccac cccaggtgtc ctgtccattc tcaggctggt cacatgggtg      1740
     gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga      1800
     ccccccaaag acacatgtga cccaccaccc catctctgac catgaggcca ccctgaggtg      1860
     ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga      1920
     ccaaactcag gacaccgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa      1980
     gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca      2040
     tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata      2100
     tctgttctca gggaaagcag gagcccttct ggagcccttc agcagggtca gggcccctca      2160
     tcttcccctc ctttcccaga gccatcttcc cagtccacca tccccatcgt gggcattgtt      2220
     gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctac tgtgatgtgt      2280
     aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt cttgtcccac      2340
     tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa gcagcatcca      2400
     cacaggggct aacgcagcct gggaccctgt gtgccagcac ttactctttt gtgcagcaca      2460
     tgtgacaatg aaggacagat gtatcgcctt gatggttgtg gtgttggggt cctgattcca      2520
     gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggaggg cagttggtcc      2580
     aggacccaca cttgctttcc tcgtgtttcc tgatcctgcc ctgggtctgt agtcatactt      2640
     ctggaaattc cttttggttc caagacgagg aggttcctct aagatctcat ggtcctgctt      2700
     cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg gagctactct      2760
     caggctgcgt gtaagtggtg ggggtgggag tgtggaggag ctcacccacc ccataattcc      2820
     tcctgtccca cgtctcctgc gggctctgac caggtcctgt ttttgttcta ctccagccag      2880
     cgacagtgcc cagggctctg atgtgtctct cacagcttga aaaggtgaga ttcttggggt      2940
     ctagagtggg tggggtggcg ggtctggggg tgggtggggc agtggggaaa ggcctgggta      3000
     atggagattc tttgattggg atgtttcgcg tgtgtcgtgg gctgttcaga gtgtcatcac      3060
     ttaccatgac taaccagaat ttgttcatga ctgttgtttt ctgtagcctg agacagctgt      3120
     cttgtgaggg actgagatgc aggatttctt cacgcctccc ctttgtgact tcaagagcct      3180
     ctggcatctc tttctgcaaa ggcacctgaa tgtgtctgcg tccctgttag cataatgtga      3240
     ggaggtggag agacagccca cccttgtgtc cactgtgacc cct                        3283
//


spacer
spacer