spacer

EBI Dbfetch

ID   DQ206450; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   DQ206450;
XX
DT   17-AUG-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (DPB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RX   DOI; 10.1111/j.1399-0039.2006.00630.x.
RX   PUBMED; 16866899.
RA   Li M., Nie J., Xu Y., Xu A., Yu X.;
RT   "Identification of a novel HLA-DPB1 allele, DPB1*1702";
RL   Tissue Antigens 68(2):187-188(2006).
XX
RN   [2]
RP   1-264
RA   Li M., Xu Y., Yu X.;
RT   ;
RL   Submitted (15-SEP-2005) to the INSDC.
RL   Department of Nephrology, 1st Affiliated Hospital, Zhongshan Medical
RL   College, Sun Yat-Sen University, Zhongshan Road II, Guangzhou, Guangdong
RL   510089, China
XX
DR   MD5; 0bf33fd711cc69211e7b632a7994f0d1.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="DPB1"
FT   mRNA            <1..>264
FT                   /gene="DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*114:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="ABB17974.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTE
FT                   LGRPEAEYWNSQKDLLEEKRAVPDRVCRHNYELDEAVTLQRR"
FT   exon            <1..>264
FT                   /gene="DPB1"
FT                   /number=2
XX
SQ   Sequence 264 BP; 62 A; 65 C; 98 G; 39 T; 0 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagc tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg aggcggagta ctggaacagc cagaaggacc       180
     tcctggagga gaagcgggca gtgccggaca gggtatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//


spacer
spacer