Dbfetch

ID   DQ196429; SV 1; linear; genomic DNA; STD; HUM; 3270 BP.
XX
AC   DQ196429;
XX
DT   19-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07NE allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3270
RA   Alonso-Nieto M., Vicario J.L.;
RT   "New HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3270
RA   Alonso-Nieto M., Vicario J.L.;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   Histocompatibilidad, Centro de Transfusion de Madrid, Av de la Democracia
RL   s/n, Madrid 28032, Spain
XX
DR   MD5; 03ee83997251cdeeec6269f547238122.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <232..>2907
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07NE"
FT   mRNA            join(<232..304,433..702,948..1223,1798..2073,2167..2283,
FT                   2725..2757,2864..>2907)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07NE"
FT                   /product="MHC class I antigen"
FT   CDS             join(232..304,433..702,948..1223,1798..2073,2167..2283,
FT                   2725..2757,2864..2907)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07NE"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q38PK6"
FT                   /db_xref="IMGT/HLA:B*07:44"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q38PK6"
FT                   /protein_id="ABB00288.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCQVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 3270 BP; 604 A; 946 C; 1031 G; 689 T; 0 other;
     agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc ctgagtttca        60
     cttcttctcc caacttgtgt cgggtccttc ttccaggata ctcgtgacgc gtccccactt       120
     cccactccca ttgggtattg gatatctaga gaagccaatc agcgtcgccg cggtcccagt       180
     tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccga gatgctggtc       240
     atggcgcccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac cgagacctgg       300
     gccggtgagt gcgggtcggg agggaaatgg cctctgccgg gaggagcgag gggaccgcag       360
     gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct       420
     cctcaccccc aggctcccac tccatgaggt atttctacac ctccgtgtcc cggcccggcc       480
     gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacccagttc gtgaggttcg       540
     acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag caggaggggc       600
     cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact gaccgagaga       660
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       720
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       780
     tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg gcgagagccc       840
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg       900
     gcggggcggg gctcggggga ctgggctgac cgcggggccg gggccagggt ctcacaccct       960
     ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca      1020
     gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc      1080
     cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca      1140
     gcggagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc tggagaacgg      1200
     gaaggacaag ctggagcgcg ctggtaccag gggcagtggg gagccttccc catctcctat      1260
     aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt      1320
     cgccctccgt tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc      1380
     ttctctctag acaattaagg aatgacgtct ctgaggaaat ggaggggaag acagtcccta      1440
     gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg tgacttttcc      1500
     tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt ccagcacttc      1560
     tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg ctcagagact      1620
     cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg gtgtctgggt      1680
     tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca catgggtggt      1740
     cctagggtgt cccatgaaag atgcaaagcg cctgaatttt ctgactcttc ccatcagacc      1800
     ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc ctgaggtgct      1860
     gggccctggg tttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc      1920
     aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc ttccagaagt      1980
     gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccag gtacagcatg      2040
     aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag gggtcatatc      2100
     tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct tcccctcctt      2160
     tcccagagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct ggcctggctg      2220
     tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg aggaagagtt      2280
     caggtaggga aggggtgagg ggtggggtct gggttttctt gtcccactgg gggtttcaag      2340
     ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatgcacac aggggctaac      2400
     gcagcctggg accctgtgtg ccagcactta ctcttttgtg cagcacatgt gacaatgaag      2460
     gatggatgta tcaccttgat ggttgtggtg ttggggtcct gattccagca ttcatgagtc      2520
     aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg acccacactt      2580
     gctttcctcg tgtttcctga tcctgccctg ggtctgtagt catacttctg gaaattcctt      2640
     ttgggtccaa gactaggagg ttcctctaag atctcatggc cctgcttcct cccagtgccc      2700
     tcacaggaca ttttcttccc acaggtggaa aaggagggag ctactctcag gctgcgtgta      2760
     agtggtgggg gtgggagtgt ggaggagctc acccacccca taattcctcc tgtcccacgt      2820
     ctcctgcggg ctctgaccag gtcctgtttt tgttctactc caggcagcga cagtgcccag      2880
     ggctctgatg tgtctctcac agcttgaaaa ggtgagattc ttggggtcta gagtgggtgg      2940
     ggtggcgggt ctgggggtgg gtggggcaga ggggaaaggc ctgggtaatg gggattcttt      3000
     gattgggatg tttcgcgtgt gtggtgggct gtttagagtg tcatcgctta ccatgactaa      3060
     ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt gtgagggact      3120
     gagatgcagg atttcttcac gcctcccctt tgtgacttca agagcctctg gcatctcttt      3180
     ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga ggtggagaga      3240
     cagcccaccc ttgtgtccac tgtgacccct                                       3270
//