spacer

EBI Dbfetch

ID   DQ191503; SV 1; linear; genomic DNA; STD; ROD; 1233 BP.
XX
AC   DQ191503;
XX
DT   06-MAR-2006 (Rel. 87, Created)
DT   06-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Chrotomys gonzalesi interphotoreceptor retinoid-binding protein (IRBP)
DE   gene, partial cds.
XX
KW   .
XX
OS   Chrotomys gonzalesi (Isarog striped shrew-rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Chrotomys.
XX
RN   [1]
RP   1-1233
RX   DOI; 10.1080/10635150500431254.
RX   PUBMED; 16507525.
RA   Jansa S.A., Barker F.K., Heaney L.R.;
RT   "The pattern and timing of diversification of Philippine endemic rodents:
RT   evidence from mitochondrial and nuclear gene sequences";
RL   Syst. Biol. 55(1):73-88(2006).
XX
RN   [2]
RP   1-1233
RA   Jansa S.A., Barker F.Keith., Heaney L.R.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Bell Museum of Natural History, University of Minnesota, 1987 Upper Buford
RL   Circle, St. Paul, MN 55108, USA
XX
DR   MD5; b4353c7e970da04862bf3c01e863d151.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1233
FT                   /organism="Chrotomys gonzalesi"
FT                   /isolate="EAR850"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="USNM 458953"
FT                   /db_xref="taxon:237998"
FT   gene            <1..>1233
FT                   /gene="IRBP"
FT   mRNA            <1..>1233
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1233
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q284P3"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q284P3"
FT                   /protein_id="ABB00273.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLSI
FT                   SYEPNTLEAPPQAPALTNLTQEELLAQIQRNIHHEVLEGNVGYLRVDDLPGQEVLSEVG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERMEGGALDL
FT                   QKLRIGQSNFFITVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQQALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVKATGPRETSSRPETGPNDPPADTPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLRTLG"
XX
SQ   Sequence 1233 BP; 274 A; 350 C; 357 G; 252 T; 0 other;
     ctgatgggaa tgcaagcagc cattgagcag gccatgaaga gtcatgagat tctgggcatc        60
     tcagaccctc agacgctggc ccatgtgctg acagctggag tacagagttc cttgaatgac       120
     ccacgtctct ccatctccta tgagcccaat acccttgagg ctcccccgca agcaccagca       180
     ctcaccaacc tcacccaaga agaactgctg gcccagatac agaggaacat ccaccatgaa       240
     gttcttgagg gcaacgtggg ctacctacga gtggatgacc tccctggcca ggaggtactg       300
     agtgaggtgg gggagttctt agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgttag atctccggca ctgtgctggt ggccacgttt ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cactgtcatg catgtggata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttaccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtag tggtcctcac cagtggacat actggaggag tggccgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggatggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccagtcc aacttcttca tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agctctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gggttgtcct ccgacttcag caagccctac aggactatta cacattagtg       900
     gaccgagtgc caggcctgct gcaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg ctgtgtcaga ggatcccagg      1020
     ctcctggtga aagccactgg acccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagacacccc tgaggtgcca aaggaagaag atgcccggag ggccctagtg      1140
     gactctgtgt ttcaggtgtc tgtgctgccg gggaacgtgg gctacctgcg ttttgacaga      1200
     tttgcagatg cttctgtgct gaggacactg ggc                                   1233
//


spacer
spacer