spacer

EBI Dbfetch

ID   DQ191495; SV 1; linear; genomic DNA; STD; ROD; 1233 BP.
XX
AC   DQ191495;
XX
DT   06-MAR-2006 (Rel. 87, Created)
DT   06-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Archboldomys luzonensis interphotoreceptor retinoid-binding protein (IRBP)
DE   gene, partial cds.
XX
KW   .
XX
OS   Archboldomys luzonensis (Isarog shrew-mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Archboldomys.
XX
RN   [1]
RP   1-1233
RX   DOI; 10.1080/10635150500431254.
RX   PUBMED; 16507525.
RA   Jansa S.A., Barker F.K., Heaney L.R.;
RT   "The pattern and timing of diversification of Philippine endemic rodents:
RT   evidence from mitochondrial and nuclear gene sequences";
RL   Syst. Biol. 55(1):73-88(2006).
XX
RN   [2]
RP   1-1233
RA   Jansa S.A., Barker F.Keith., Heaney L.R.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Bell Museum of Natural History, University of Minnesota, 1987 Upper Buford
RL   Circle, St. Paul, MN 55108, USA
XX
DR   MD5; 68f88cf92072579fa13d0a72f2ea3ce0.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1233
FT                   /organism="Archboldomys luzonensis"
FT                   /isolate="LRH4098"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="USNM 573834"
FT                   /db_xref="taxon:237995"
FT   gene            <1..>1233
FT                   /gene="IRBP"
FT   mRNA            <1..>1233
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1233
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q284Q1"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniProtKB/TrEMBL:Q284Q1"
FT                   /protein_id="ABB00265.1"
FT                   /translation="LMGMQAAIEQAMKSHEILDISDPQTLAHVLTAGVQSSLNDPRLSI
FT                   SYEPSTLEAPPQAPALTNLTREELLAQIQRNIHHEILEGNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCAGGHISGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERMEGGALDL
FT                   QKLRIGQSNFFITVPVSRSLGPLGGSGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQQALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVKATGPRETSSRPETGPNDPPTDTPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADTSVLRTLG"
XX
SQ   Sequence 1233 BP; 279 A; 353 C; 349 G; 252 T; 0 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctggacatc        60
     tcagaccctc agacgctggc ccatgtgctg acagctggag tacagagttc cttgaatgac       120
     ccacgtctct ccatctccta tgagcccagt accctcgagg ctcccccgca agcaccagca       180
     ctcaccaacc tcacccgaga agaactgctg gctcagatac agaggaacat ccaccatgaa       240
     attcttgagg gcaacgtggg ctacctacgg gtggatgacc tccctggcca ggaggtactg       300
     agtgagctgg gggagttctt agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgttag atctccggca ctgtgctggt ggccacatct ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cactgtcatg cacgtggata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttaccc aaggtcttag gagagagata cagtgctgac       540
     aaagatgtag tggtcctcac cagtggacat actgggggag tggctgagga catcgcctac       600
     attctcaagc aaatgcgcag ggccatcgtg gtgggtgagc ggatggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccagtcc aacttcttca tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aagtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gggttgtcct ccgacttcag caagccctac aggactatta cacattagtg       900
     gacagagtgc caggcctgct gcaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg ctgtgtcaga ggatcccagg      1020
     ctcctggtga aagccactgg acccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccaa cagacacccc tgaggtgccc aaggaagaag atgcccggag ggccctagta      1140
     gactctgtgt ttcaggtgtc tgtgctgcca ggcaacgtgg gctacctgcg ttttgacaga      1200
     tttgccgaca cttctgtgct gaggacactg ggc                                   1233
//


spacer
spacer