spacer

EBI Dbfetch

ID   DQ191486; SV 1; linear; genomic DNA; STD; ROD; 1137 BP.
XX
AC   DQ191486;
XX
DT   06-MAR-2006 (Rel. 87, Created)
DT   06-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Rattus exulans cytochrome b (cytb) gene, partial cds; mitochondrial.
XX
KW   .
XX
OS   Rattus exulans (Polynesian rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1137
RX   DOI; 10.1080/10635150500431254.
RX   PUBMED; 16507525.
RA   Jansa S.A., Barker F.K., Heaney L.R.;
RT   "The pattern and timing of diversification of Philippine endemic rodents:
RT   evidence from mitochondrial and nuclear gene sequences";
RL   Syst. Biol. 55(1):73-88(2006).
XX
RN   [2]
RP   1-1137
RA   Jansa S.A., Barker F.Keith., Heaney L.R.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Bell Museum of Natural History, University of Minnesota, 1987 Upper Buford
RL   Circle, St. Paul, MN 55108, USA
XX
DR   MD5; 3a7db02d0a9b76c63911afc62f5d44c3.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1137
FT                   /organism="Rattus exulans"
FT                   /organelle="mitochondrion"
FT                   /isolate="EAR1598"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="USNM 458836"
FT                   /db_xref="taxon:34854"
FT   gene            1..>1137
FT                   /gene="cytb"
FT   CDS             1..>1137
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q284R0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q284R0"
FT                   /protein_id="ABB00256.1"
FT                   /translation="MTNIRKSHPLLKIINHSFIDLPAPSNISSWWNFGSLLGVCLMIQI
FT                   ITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGIVLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDLLGVFMLLLFLMTLVLFFPDLLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVVALVLSILILALLPFLHTSKQRSLTFRPITQTLYWILVANLFILTWIGG
FT                   QPVEHPFIIIGQLASMSYFSIILILMPISGIIEDKMLKW"
XX
SQ   Sequence 1137 BP; 351 A; 323 C; 137 G; 326 T; 0 other;
     atgacaaaca ttcgaaaatc tcatcctcta ctcaaaatta ttaatcactc ctttattgac        60
     cttcccgctc catccaacat ctcatcatga tgaaactttg gctctctatt aggagtatgc       120
     ctaataattc aaatcattac aggcctgttc ctagcaatac actacacatc cgacactcta       180
     acagcattct catcagttac ccacatctgc cgagacgtaa actacggctg actaattcga       240
     tacttacatg ccaacggagc ttcaatattc tttatctgct tattcctcca cgtaggacga       300
     ggaatgtact atggatccta caccttccta gaaacatgaa acatcggaat cgtcctacta       360
     tttgcagtca tagccaccgc attcataggc tacgtacttc catgaggaca aatatcattc       420
     tgaggagcca cagtaattac aaatctacta tcagctatcc cctatatcgg cactacccta       480
     gtcgaatgaa tctgaggggg attctcagta gacaaagcaa ccctaactcg ttttttcgca       540
     tttcacttca ttctcccatt catcatcgcc gctcttgcaa tcgtacatct ccttttcctc       600
     cacgaaacag gatcaaacaa ccccacaggc ctaaattctg atgcagataa aatcccattt       660
     catccatact acacaattaa agacctacta ggagtattta tattacttct atttttaata       720
     accctagtat tattcttccc agacttacta ggagatccag acaattatat acctgccaac       780
     cccctaaata ccccaccaca tatcaaacca gaatgatatt ttctcttcgc ttacgccatt       840
     ttacgctcca ttcccaacaa attaggagga gtagtagcct tagtcctatc aatcctaatc       900
     ttagccctcc taccattcct ccacacttca aaacaacgca gcctaacatt ccgcccaatt       960
     acccaaaccc tatactgaat cctagtagct aacctcttca tcctaacatg aattggaggc      1020
     caaccagtag aacatccttt catcatcatt ggccaactag catctataag ctacttctca      1080
     attattctta tcctaatacc tatctctgga atcattgaag acaaaatact aaaatga         1137
//


spacer
spacer