spacer

EBI Dbfetch

ID   DQ191484; SV 1; linear; genomic DNA; STD; ROD; 1137 BP.
XX
AC   DQ191484;
XX
DT   06-MAR-2006 (Rel. 87, Created)
DT   06-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Phloeomys cumingi cytochrome b (cytb) gene, partial cds; mitochondrial.
XX
KW   .
XX
OS   Phloeomys cumingi (Southern Luzon giant cloud rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Phloeomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1137
RX   DOI; 10.1080/10635150500431254.
RX   PUBMED; 16507525.
RA   Jansa S.A., Barker F.K., Heaney L.R.;
RT   "The pattern and timing of diversification of Philippine endemic rodents:
RT   evidence from mitochondrial and nuclear gene sequences";
RL   Syst. Biol. 55(1):73-88(2006).
XX
RN   [2]
RP   1-1137
RA   Jansa S.A., Barker F.Keith., Heaney L.R.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Bell Museum of Natural History, University of Minnesota, 1987 Upper Buford
RL   Circle, St. Paul, MN 55108, USA
XX
DR   MD5; 846b0d76b3d910cf1356c2ce681dd7c8.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1137
FT                   /organism="Phloeomys cumingi"
FT                   /organelle="mitochondrion"
FT                   /isolate="EAR1699"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="USNM 573332"
FT                   /db_xref="taxon:248813"
FT   gene            1..>1137
FT                   /gene="cytb"
FT   CDS             1..>1137
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q284R2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q284R2"
FT                   /protein_id="ABB00254.1"
FT                   /translation="MTNIRKTHPLFKIINNSFIDLPTPSNISSWWNFGSLLGMCLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYIHANGASMFFICLFLHVGRGIYY
FT                   GSYNFTETWNIGIILLFTTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFVITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YFTIKDLLGALMMLTSLLALVLFFPDVLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPLMHTSKQRSLMFRPITQTLYWMLVANLLILTWVGG
FT                   QPVEYPFTIIGQLASISYFSIILILMPISGIIEDKMLKL"
XX
SQ   Sequence 1137 BP; 383 A; 337 C; 133 G; 284 T; 0 other;
     atgacaaaca tccgaaaaac ccacccacta tttaaaatca tcaacaactc attcatcgac        60
     ctacccacac catccaatat ctcatcatga tgaaacttcg gctctctcct aggaatgtgc       120
     ctaataatcc aaatcatcac aggtttattc ctagccatac actatacatc agacacaaca       180
     acagcattct catcagtaac acatatctgc cgagacgtaa actatggatg acttatccgt       240
     tatatccacg caaacggagc atcaatattc ttcatctgct tattcctcca cgtaggacga       300
     ggaatttact acggatccta caacttcaca gaaacatgaa acatcggaat cattctacta       360
     ttcacaacca tagctactgc atttataggc tacgtactcc catgaggaca aatatcattc       420
     tgaggggcaa cagtcatcac caacctacta tcagctatcc catacattgg aacaacatta       480
     gttgaatgaa tctggggcgg attctcagta gacaaagcca ccctaacacg cttcttcgcc       540
     ttccatttca tcctcccatt tgtaatcaca gccctagtaa tcgtccacct cctattcctt       600
     cacgaaacag gctcaaacaa tcctacaggc ctaaactcag acgcagacaa aattccattc       660
     cacccatact ttacaatcaa ggacctccta ggagctctaa taatactaac atccttatta       720
     gccttagtat tattcttccc agacgtccta ggagacccag acaactacac accagcaaac       780
     ccactaaaca cacccccaca catcaaacca gaatgatatt tcctatttgc atacgctatc       840
     ttacgctcta tcccaaacaa actaggagga gtactagccc taatcctatc tatcctaatt       900
     ctagcattcc ttccactaat acacacctca aaacaacgaa gccttatatt ccgcccaatc       960
     acacaaacac tatactgaat actagtagcc aacctcctaa tcttaacctg agttggagga      1020
     caaccagtag aatacccatt caccatcatt ggacaactag cctcaatcag ctatttctcc      1080
     atcatcctaa tcttaatacc aatctcagga atcatcgaag acaaaatatt aaaacta         1137
//


spacer
spacer