spacer

EBI Dbfetch

ID   DQ188812; SV 1; linear; genomic DNA; STD; HUM; 3274 BP.
XX
AC   DQ188812;
XX
DT   26-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*53v allele, exons 1
DE   through 7 and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3274
RA   Alonso-Nieto M., Vicario J.L.;
RT   "New HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3274
RA   Alonso-Nieto M., Vicario J.L.;
RT   ;
RL   Submitted (01-SEP-2005) to the INSDC.
RL   Histocompatibilidad, Centro de Transfusion de Madrid, Av de la Democracia
RL   s/n, Madrid 28032, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3274
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <232..>2920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT   mRNA            join(<232..304,434..703,949..1224,1800..2075,2180..2296,
FT                   2738..2770,2877..>2920)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /product="MHC class I antigen"
FT   CDS             join(232..304,434..703,949..1224,1800..2075,2180..2296,
FT                   2738..2770,2877..2920)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q3LRR5"
FT                   /db_xref="IMGT/HLA:B*53:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LRR5"
FT                   /protein_id="ABA29237.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <232..304
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=1
FT   exon            434..703
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=2
FT   exon            949..1224
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=3
FT   exon            1800..2075
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=4
FT   exon            2180..2296
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=5
FT   exon            2738..2770
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=6
FT   exon            2877..>2920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53v"
FT                   /number=7
XX
SQ   Sequence 3274 BP; 610 A; 957 C; 1021 G; 686 T; 0 other;
     agagccttgt ctgcattggg gaggcgcagc gttggggatt ccccactccc acgagtttca        60
     cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc gtccccattt       120
     cccactccca ttgggtgtcg gatatctaga gaagccaatc agtgtcgccg gggtcccagt       180
     tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga gatgcgggtc       240
     acggcgcccc gaaccgtcct cctgctgctc tggggggcag tggccctgac cgagacctgg       300
     gccggtgagt gcggggtcgg gagggaaatg gcctctgtgg ggaggagcga ggggaccgca       360
     ggcgggggcg caggacctga ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc       420
     tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       480
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       540
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       600
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       660
     aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccggtgagtg accccggccc       720
     ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc gagtctccgg       780
     gtccgagatc cgcctccctg aggccgcggg acccgcccag accctcgacc ggcgagagcc       840
     ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg       900
     ggcggggcgg ggctcggggg acggggctga ccgcggggcc ggggccaggg tctcacatca       960
     tccagaggat gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggcatgacc      1020
     agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg      1080
     cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc      1140
     agcggagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac ctggagaacg      1200
     ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta      1260
     taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag cgctagaatg      1320
     tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg agggccccct      1380
     cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga agacagtccc      1440
     tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac cgtgactttt      1500
     cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga ttccagcact      1560
     tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc cgctcagaga      1620
     ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc tggtgtctgg      1680
     gttctgtgcc ccttccccac accaggtgtc ctgtccattc tcaggctggt cacatgggtg      1740
     gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga      1800
     ccccccaaag acacacgtga cccaccaccc cgtctctgac catgaggcca ccctgaggtg      1860
     ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga      1920
     ccaaactcag gacactgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa      1980
     gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca      2040
     tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata      2100
     tctcttctca gggaaagcag gagcccttct ggagcccttc agcagggtca gggcccctcg      2160
     tcttcccctc ctttcccaga gccatcttcc cagtccacca tccccatcgt gggcattgtt      2220
     gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctac tgtgatgtgt      2280
     aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt cttgtcccac      2340
     tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa gcagcatcca      2400
     cacaggggct aacgcagcct gggaccctgt gtgccagcac ttactctttt gtgcagcaca      2460
     tgtgacaatg aaggacggat gtatcacctt gatggttgtg gtgttggggt cctgatttca      2520
     gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggaggg cagttggtcc      2580
     aggacccaca cttgctttcc tcgtgtttcc tgatcctgcc ttgggtctgt agtcatactt      2640
     ctggaaattc cttttgggtc caagacgagg aggttcctct aagatctcat ggccctgctt      2700
     cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg gagctactct      2760
     caggctgcgt gtaagtggtg ggggtgggag tgtggaggag ctcacccacc ccataattcc      2820
     tcctgtccca cgtctcctgc gggctctgac caggtcctgt ttttgttcta ctccagccag      2880
     cgacagtgcc cagggctctg atgtgtctct cacagcttga aaaggtgaga ttcttggggt      2940
     ctagagtggg cggggggggc ggggaggggg cagaggggaa aggcctgggt aatggagatt      3000
     ctttgattgg gatgtttcgc gtgtgtcgtg ggctgttcag agtgtcatca cttaccatga      3060
     ctaaccagaa tttgttcatg actgttgttt tctgtagcct gagacagctg tcttgtgagg      3120
     gactgagatg caggatttct tcactcctcc cctttgtgac ttcaagagcc tctggcatct      3180
     ctttctgcaa aggcacctga atgtgtctgc gtccctgtta gcctaatgtg aggaggtgga      3240
     gagacagccc acccccgtgt ccactgtgac ccct                                  3274
//


spacer
spacer