spacer

EBI Dbfetch

ID   DQ188810; SV 1; linear; genomic DNA; STD; HUM; 3371 BP.
XX
AC   DQ188810;
XX
DT   26-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02v allele, exons 1
DE   through 8 and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3371
RA   Alonso-Nieto M., Vicario J.L.;
RT   "New HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3371
RA   Alonso-Nieto M., Vicario J.L.;
RT   ;
RL   Submitted (01-SEP-2005) to the INSDC.
RL   Histocompatibilidad, Centro de Transfusion de Madrid, Av de la Democracia
RL   s/n, Madrid 28032, Spain
XX
DR   MD5; 782c923ac311a590d29e9e85b6a6b5e0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3371
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <281..>3197
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT   mRNA            join(<281..353,484..753,995..1270,1871..2146,2246..2362,
FT                   2801..2833,2976..3023,3193..>3197)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /product="MHC class I antigen"
FT   CDS             join(281..353,484..753,995..1270,1871..2146,2246..2362,
FT                   2801..2833,2976..3023,3193..3197)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q3LRR7"
FT                   /db_xref="IMGT/HLA:A*02:89"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LRR7"
FT                   /protein_id="ABA29235.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHQAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <281..353
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=1
FT   exon            484..753
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=2
FT   exon            995..1270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=3
FT   exon            1871..2146
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=4
FT   exon            2246..2362
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=5
FT   exon            2801..2833
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=6
FT   exon            2976..3023
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=7
FT   exon            3193..>3197
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02v"
FT                   /number=8
XX
SQ   Sequence 3371 BP; 649 A; 969 C; 1031 G; 722 T; 0 other;
     cgaagtccca gggccccagg cgtggctctc agggtctcag gccccgaagg cggtgtatgg        60
     attggggagt cccagccttg gggattcccc aactccgcag tttcttttct ccctctccca       120
     acctatgtag ggtccttctt cctggatact cacgacgcgg acccagttct cactcccatt       180
     gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg gtcgcggttc taaagtccgc       240
     acgcacccac cgggactcag attctcccca gacgccgagg atggccgtca tggcgccccg       300
     aaccctcgtc ctgctactct cgggggctct ggccctgacc cagacctggg cgggtgagtg       360
     cggggtcggg agggaaacgg cctctgtggg gagaagcaac gggcccgcct ggcgggggcg       420
     caggacccgg gaagccgcgc cgggaggagg gtcgggcggg tctcagccac tcctcgtccc       480
     caggctctca ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc       540
     cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg       600
     ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt ccggagtatt       660
     gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg gacctgggga       720
     ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg       780
     tcacgacctc tcatccccca cggacgggcc aggtcgccca cagtctccgg gtccgagatc       840
     cgccccgaag ccgcgggacc ccgagaccct tgccccggga gaggcccagg cgcctttacc       900
     cggtttcatt ttcagtttag gccaaaaatc cccccaggtt ggtcggggcg gggcggggct       960
     cgggggaccg ggctgaccgc ggggtccggg ccaggttctc acaccgtcca gaggatgtat      1020
     ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt accaccagta cgcctacgac      1080
     ggcaaggatt acatcgccct gaaagaggac ctgcgctctt ggaccgcggc ggacatggca      1140
     gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg cggagcagtt gagagcctac      1200
     ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg      1260
     cagcgcacgg gtaccagggg ccacggggcg cctccctgat cgcctgtaga tctcccgggc      1320
     tggcctccca caaggagggg agacaattgg gaccaacact agaatatcgc cctccctctg      1380
     gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag tgactctgag      1440
     gttccgccct gctctctgac acaattaagg gataaaatct ctgaaggaat gacgggaaga      1500
     cgatccctcg aatactgatg agtggttccc tttgacacac acaggcagca gccttgggcc      1560
     cgtgactttt cctctcaggc cttgttctct gcttcacact caatgtgtgt gggggtctga      1620
     gtccagcact tctgagtcct tcagcctcca ctcaggtcag gaccagaagt cgctgttccc      1680
     tcttcaggga ctagaatttt ccacggaata ggagattatc ccaggtgcct gtgtccaggc      1740
     tggtgtctgg gttctgtgct cccttcccca tcccaggtgt cctgtccatt ctcaagatag      1800
     ccacatgtgt gctggaggag tgtcccatga cagatgcaaa atgcctgaat gatctgactc      1860
     ttcctgacag acgcccccaa aacgcatatg actcaccaag ctgtctctga ccatgaagcc      1920
     accctgaggt gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg      1980
     gatggggagg accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga      2040
     accttccaga agtgggcggc tgtggtggtg ccttctggac aggagcagag atacacctgc      2100
     catgtgcagc atgagggttt gcccaagccc ctcaccctga gatggggtaa ggagggagac      2160
     gggggtgtca tgtcttttag ggaaagcagg agcctctctg acctttagca gggtcagggc      2220
     ccctcacctt cccctctttt cccagagccg tcttcccagc ccaccatccc catcgtgggc      2280
     atcattgctg gcctggttct ctttggagct gtgatcactg gagctgtggt cgctgctgtg      2340
     atgtggagga ggaagagctc aggtggggaa ggggtgaagg gtgggtctga gatttcttgt      2400
     ctcactgagg gttccaagac ccaggtagaa gtgtgccctg cctcgttact gggaagcacc      2460
     acccacaatt atgggcctac ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa      2520
     agcacctgtt aaaatgaagg acagatttat caccttgatt acagcggtga tgggacctga      2580
     tcccagcagt cacaagtcac aggggaaggt ccctgaggac cttcaggagg gcggttggtc      2640
     caggacccac acctgctttc ttcatgtttc ctgatcccgc cctgggtctg cagtcacaca      2700
     tttctggaaa cttctctgag gtccaagact tggaggttcc tctaggacct taaggccctg      2760
     actcctttct ggtatctcac aggacatttt cttcccacag atagaaaagg agggagctac      2820
     tctcaggctg caagtaagta tgaaggaggc tgatgcctga ggtccttggg atattgtgtt      2880
     tgggagccca tgggggagct cacccacccc acaattcctc ctctagccac atcttctgtg      2940
     ggatctgacc aggttctgtt tttgttctac cccaggcagt gacagtgccc agggctctga      3000
     tgtgtctctc acagcttgta aaggtgagag cctggagggc ctgatgtgtg ttgggtgttg      3060
     ggcggaacag tggacacagc tgtgctatgg ggtttctttc cattggatgt attgagcatg      3120
     cgatgggctg tttaaagtgt gacccctcac tgtgacagat acgaatttgt tcatgaatat      3180
     ttttttctat agtgtgagac agctgccttg tgtgggactg agaggcaaga gttgttcctg      3240
     cccttccctt tgtgacttga agaaccctga ctttgtttct gcaaaggcac ctgcatgtgt      3300
     ctgtgttcgt gtaggcataa tgtgaggagg tggggagacc accccacccc catgtccacc      3360
     atgaccctct t                                                           3371
//


spacer
spacer