spacer

EBI Dbfetch

ID   DQ188808; SV 1; linear; genomic DNA; STD; HUM; 3356 BP.
XX
AC   DQ188808;
XX
DT   26-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24v allele, exons 1
DE   through 8 and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3356
RA   Alonso-Nieto M., Vicario J.L.;
RT   "New HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3356
RA   Alonso-Nieto M., Vicario J.L.;
RT   ;
RL   Submitted (01-SEP-2005) to the INSDC.
RL   Histocompatibilidad, Centro de Transfusion de Madrid, Av de la Democracia
RL   s/n, Madrid 28032, Spain
XX
DR   MD5; 739b4ee3c4a555c2b699fa358ad07744.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3356
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <281..>3182
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT   mRNA            join(<281..353,484..753,995..1270,1850..2125,2228..2344,
FT                   2787..2819,2962..3009,3178..>3182)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /product="MHC class I antigen"
FT   CDS             join(281..353,484..753,995..1270,1850..2125,2228..2344,
FT                   2787..2819,2962..3009,3178..3182)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95J06"
FT                   /db_xref="IMGT/HLA:A*24:02:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95J06"
FT                   /protein_id="ABA29233.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <281..353
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=1
FT   exon            484..753
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=2
FT   exon            995..1270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=3
FT   exon            1850..2125
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=4
FT   exon            2228..2344
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=5
FT   exon            2787..2819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=6
FT   exon            2962..3009
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=7
FT   exon            3178..>3182
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24v"
FT                   /number=8
XX
SQ   Sequence 3356 BP; 644 A; 973 C; 1027 G; 712 T; 0 other;
     cgaagtccca gggccccagg cgtggctctc agggtctcag gccccgaagg cggtgtatgg        60
     attggggagt cccagccttg gggattcccc aactccgcag tttcttttct ccctctccca       120
     acctatgtag ggtccttctt cctggatact cacgacgcgg acccagttct cactcccatt       180
     gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg gtcgctgttc taaagtccgc       240
     acgcacccac cgggactcag attctcccca gacgccgagg atggccgtca tggcgccccg       300
     aaccctcgtc ctgctactct cgggggccct ggccctgacc cagacctggg caggtgagtg       360
     cggggtcggg agggaaacgg cctctgcggg gagaagcaag gggcccgcct ggcgggggcg       420
     caagacccgg gaagccgcgc cgggaggagg gtcgggcggg tctcagccac tcctcgtccc       480
     caggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc cgcggggagc       540
     cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg       600
     ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt       660
     gggacgagga gacagggaaa gtgaaggccc actcacagac tgaccgagag aacctgcgga       720
     tcgcgctccg ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg       780
     tcacgacccc tcatccccca cggacgggcc gggtcgccca cagtctccgg gtccgagatc       840
     caccccgaag ccgcgggacc ccgagaccct tgccccggga gaggcccagg cgccttaacc       900
     cggtttcatt ttcagtttag gccaaaaatc cccccgggtt ggtcggggcc gggcggggct       960
     cgggggactg ggctgaccgc ggggtcgggg ccaggttctc acaccctcca gatgatgttt      1020
     ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt accaccagta cgcctacgac      1080
     ggcaaggatt acatcgccct gaaagaggac ctgcgctctt ggaccgcggc ggacatggcg      1140
     gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg cggagcagca gagagcctac      1200
     ctggagggca cgtgcgtgga cgggctccgc agatacctgg agaacgggaa ggagacgctg      1260
     cagcgcacgg gtaccagggg ccacggggcg cctacctgat cgcctgtagg tctcccgggc      1320
     tggcctccca caaggagggg agacaattgg gaccaacact agaatatcgc cctccctctg      1380
     gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag tgactctgag      1440
     gttccgccct gctctctgac acaattaagg gataaaatct ctgacggaat gacggaaaga      1500
     cgatccctcg aatactgatg actggttccc tttgacaccg gcagcagcct tgggaccgtg      1560
     acttttcctc tcaggccttg ttctctgctt cacactcaat gtgtgtgggg gtctgagtcc      1620
     agcacttctg agtccctcag cctccactca ggtcaggacc agaagtcgct gttccctcct      1680
     cagggaatag aagattatcc caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc      1740
     tcttccccat cccgggtgtc ctgtccattc tcaagatggc cacatgcatg ctggtggagt      1800
     gtcccatgac agatgcaaaa tgcctgaatt ttctgactct tcccgtcaga cccccccaag      1860
     acacatatga cccaccaccc catctctgac catgaggcca ctctgaggtg ctgggccctg      1920
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag      1980
     gacacggagc ttgtggagac caggcctgca ggggatggaa ccttccagaa gtgggcagct      2040
     gtggtggtac cttctggaga ggagcagaga tacacctgcc atgtgcagca tgagggtctg      2100
     cccaagcccc tcaccctgag atggggtaag gagggagatg ggggtgtcat gtctcttagg      2160
     gaaagcagga gcctctctgg agacctttag cagggtcagg gcccctcacc ttcccctctt      2220
     ttcccagagc catcttccca gcccaccgtc cccatcgtgg gcatcattgc tggcctggtt      2280
     ctccttggag ctgtgatcac tggagctgtg gtcgctgctg tgatgtggag gaggaacagc      2340
     tcaggtggag aaggggtgaa gggtggggtc tgagatttct tgtctcactg agggttccaa      2400
     gccccagcta gaaatgtgcc ctgtctcatt actgggaagc accatccaca atcatgggcc      2460
     gacccagcct gggccctgtg tgccagcact tactcttttg taaagcacct gtgacaatga      2520
     aggacagatt tatcaccttg attatggcgg tgatgggacc tgatcccagc agtcacaagt      2580
     cacaggggaa ggtccctgac gacagatctc aggagggcga ttggtccagg gcccacatct      2640
     gctttcttca tgtttcctga tcctgccctg ggtctgcagt cacacatttc tggaaacttc      2700
     tctggggtcc aagactagga ggttcctcta ggaccttaag gccctggctc ctttctggta      2760
     tctcacagga cattttcttc ccacagatag aaaaggaggg agctactctc aggctgcaag      2820
     taagtatgaa ggaggctgat gcctgaggtc cttgggatat tgtgtttggg agcccatggg      2880
     ggagctcaac caccccacaa ttcctcctct agccacatct tctgtgggat ctgaccaggt      2940
     tctgtttttg ttctacccca ggcagtgaca gtgcccaggg ctctgatgtg tctctcacag      3000
     cttgtaaagg tgagagcttg gagggcctga tgtgtgttgg gtgttgggcg gaacagtgga      3060
     cacagctgtg ctatggggtt tctttgcatt ggatgtattg agcatgcgat gggctgttta      3120
     aagtgtgacc cctcactgtg acagatatga agttgttcat gaattttttt tctatagtgt      3180
     gagacagctg ccttgtgtgg gactgagagg caagagttgt tcctgccctt ccctttgtga      3240
     cttgaagaac cctgactttg tttctgcaaa ggcacctgca tgtgtctgtg ttcatgtagg      3300
     cataatgtga ggaggtgggg agaccacccc acccccatgt ccaccatgac cctctt          3356
//


spacer
spacer