spacer

EBI Dbfetch

ID   DQ181794; SV 1; linear; genomic DNA; STD; HUM; 1968 BP.
XX
AC   DQ181794;
XX
DT   22-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40 new allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1968
RA   Li Y., Tang X., Yuan S., Liao C.;
RT   ;
RL   Submitted (25-AUG-2005) to the INSDC.
RL   Guangzhou Cord Blood Bank, Guangzhou Maternal and Neonatal Hospital,
RL   Renminzhong Road #398, Guangzhou, Guangdong 510180, China
XX
DR   MD5; 4f9e3fc7fcc56632167994df92e71f91.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1968
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Guangdong"
FT                   /sex="male"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1968
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 new"
FT   mRNA            join(<187..456,702..977,1552..>1827)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<187..456,702..977,1552..>1827)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q3LSM9"
FT                   /db_xref="IMGT/HLA:B*40:66"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LSM9"
FT                   /protein_id="ABA26906.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYQESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            187..456
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 new"
FT                   /number=2
FT   exon            702..977
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 new"
FT                   /number=3
FT   exon            1552..1827
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 new"
FT                   /number=4
XX
SQ   Sequence 1968 BP; 373 A; 618 C; 631 G; 346 T; 0 other;
     ccccgaaccg tcctcctgct gctctcggcg gccctggccc tgaccgagac ctgggccggt        60
     gagtgcgggt cggcagggaa atggcctctg tggggaggag cgaggggacc gcaggcgggg       120
     gcgcaggacc cggggagccg cgccgggagg agggtcgggc gggtctcagc tcctcctcgc       180
     ccccaggctc ccactccatg aggtatttcc acaccgccat gtcccggccc ggccgcgggg       240
     agccccgctt catcaccgtg ggctacgtgg acgacacgct gttcgtgagg ttcgacagcg       300
     acgccacgag tccgaggaag gagccgcggg cgccatggat agagcaggag gggccggagt       360
     attgggaccg ggagacacag atctccaaga ccaacacaca gacttaccaa gagagcctgc       420
     ggaacctgcg cggctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc       480
     aggtcacgac tccccatccc ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag       540
     atccgacccc ctgaggccgc gggacccgcc cagaccctcg accggcgaga gccccaggcg       600
     cgtttacccg gtttcatttt cagttgaggc caaaatcccc gcgggttggt cggggcgggg       660
     cggggctcgg gggactgggc tgaccgcggg gccggggcca gggtctcaca ccctccagag       720
     gatgtacggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc       780
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgccgcgga       840
     cacggcggct cagatctccc agcgcaagtt ggaggcggcc cgtgtggcgg agcagctgag       900
     agcctacctg gagggcgagt gcgtggagtg gctccgcaga tacctggaga acgggaagga       960
     caagctggag cgcgctggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1020
     ccggggatgg cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct      1080
     ccgttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1140
     ctaggacaat taaggaatga cgtctctgag gaaatggagg ggaagacagt ccctagaata      1200
     ctgatcaggg gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca      1260
     ggccttgttc tctgcctcac actcagtgtg tttgggctct gattccagca cttctgagtc      1320
     actttacctc cactcagatc aggagcagaa gtccctgttc cccgctcaga gactcgaact      1380
     ttccaatgaa taggagatta tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg      1440
     ccccttcccc accccaggtg tcctgtccat tctcaggctg gtcacatggg tggtcctagg      1500
     gtgtcccatg aaagatgcaa agcgcctgaa ttttctgact cttcccatca gaccccccaa      1560
     agacacacgt gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc      1620
     tgggtttcta ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc      1680
     aggacactga gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag      1740
     ctgtggtggt gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc      1800
     tgccgaagcc cctcaccctg agatggggta aggaggggga tgaggggtca tatctcttct      1860
     cagggaaagc aggagccctt cagcagggtc agggcccctc atcttcccct cctttcccag      1920
     agccgtcttc ccagtccacc gtccccatcg tgggcattgt tgctggcc                   1968
//


spacer
spacer