spacer

EBI Dbfetch

ID   DQ178407; SV 1; linear; genomic DNA; STD; HUM; 155 BP.
XX
AC   DQ178407;
XX
DT   24-DEC-2005 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQA1) gene, HLA-DQA1*0503 variant 1
DE   allele, exon 4 and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-155
RX   DOI; 10.1111/j.1399-0039.2006.00645.x.
RX   PUBMED; 16866887.
RA   Lee K.W., Jung Y.A., Oh D.H.;
RT   "Four novel human leukocyte antigen-DQA1 alleles identified in the Korean
RT   population";
RL   Tissue Antigens 68(2):167-172(2006).
XX
RN   [2]
RP   1-155
RA   Lee K.W.;
RT   ;
RL   Submitted (24-AUG-2005) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; e745bdf57e83c4a4059eb77af0b22b6e.
DR   Ensembl-Gn; ENSG00000196735; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232062; homo_sapiens.
DR   Ensembl-Gn; ENSG00000257473; homo_sapiens.
DR   Ensembl-Tr; ENST00000343139; homo_sapiens.
DR   Ensembl-Tr; ENST00000374949; homo_sapiens.
DR   Ensembl-Tr; ENST00000383251; homo_sapiens.
DR   Ensembl-Tr; ENST00000395363; homo_sapiens.
DR   Ensembl-Tr; ENST00000399675; homo_sapiens.
DR   Ensembl-Tr; ENST00000399678; homo_sapiens.
DR   Ensembl-Tr; ENST00000418023; homo_sapiens.
DR   Ensembl-Tr; ENST00000444296; homo_sapiens.
DR   Ensembl-Tr; ENST00000552745; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..155
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            order(DQ178404.1:<1..82,DQ178405.1:1..249,
FT                   DQ178406.1:1..282,1..>155)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT   mRNA            join(DQ178404.1:<1..82,DQ178405.1:1..249,DQ178406.1:1..282,
FT                   1..>155)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /product="MHC class II antigen"
FT   CDS             join(DQ178404.1:1..82,DQ178405.1:1..249,DQ178406.1:1..282,
FT                   1..155)
FT                   /codon_start=1
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01909"
FT                   /db_xref="HGNC:HGNC:4942"
FT                   /db_xref="IMGT/HLA:DQA1*05:06"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01909"
FT                   /protein_id="ABA86856.1"
FT                   /translation="MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPS
FT                   GQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRXFDPQFALTNIAVLKHNLNSLIKRSN
FT                   STAATNEVPEVTVFSKSPVTVGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSF
FT                   LSKSDHSFFKISYLTLLPSSEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCA
FT                   LGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL"
FT   exon            1..155
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /number=4
XX
SQ   Sequence 155 BP; 24 A; 43 C; 48 G; 40 T; 0 other;
     agcctgagat tccagcccct atgtcagagc tcacagagac tgtggtctgc gccctgggat        60
     tgtctgtggg cctcgtgggc attgtggtgg gcactgtctt catcatccga ggcctgcgtt       120
     cagttggtgc ttccagacac caagggccct tgtga                                  155
//


spacer
spacer